KEGG   Rattus norvegicus (rat): 116676Help
Entry
116676            CDS       T01003                                 

Gene name
Aldh1a2, Raldh-2
Definition
(RefSeq) aldehyde dehydrogenase 1 family, member A2
  KO
K07249  retinal dehydrogenase [EC:1.2.1.36]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00830  Retinol metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    116676 (Aldh1a2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.36  retinal dehydrogenase
     116676 (Aldh1a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487 LuxC
Motif
Other DBs
NCBI-GeneID: 116676
NCBI-ProteinID: NP_446348
RGD: 620250
Ensembl: ENSRNOG00000055049
UniProt: Q63639
Structure
PDB: 

Position
8q24
AA seq 518 aa AA seqDB search
MTSSEIAMPGEVKADPAALMASLQLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVCNP
ATGEQVCEVQEADKVDIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRATL
ATMESLNGGKPFLQAFYIDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVC
GQIIPWNFPLLMFTWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILP
GYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADAD
LDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVKRSVERAKRRIVGSPFDPTTEQG
PQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFG
PVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVSSAMQAGTVWINCYNALNAQ
SPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgacttccagcgagatcgccatgcccggcgaggtgaaggccgaccccgccgcgctcatg
gcctcgctgcagctcctgccgtcacccacgcccaacctcgagatcaagtacaccaagatc
tttattaacaatgaatggcagaactcagagagtgggagagtgttccctgtctgtaatcca
gccacaggagagcaagtgtgtgaagttcaagaagcagacaaggtggatatagacaaggca
gtgcaggcggcccgcctggccttctctcttggttctgtgtggagaaggatggacgcttct
gaaagaggacgtctgctggacaagcttgcagacttggtggaacgggacagggcaactctt
gcaactatggaatcactaaatggcggtaagccattcctgcaagctttttacatcgatttg
cagggagtcatcaaaaccctgaggtattatgcaggctgggctgataaaattcacggaatg
accattcctgtagatggagactattttaccttcacgagacatgagcccatcggagtgtgt
ggacagattatcccgtggaatttccccctgctgatgttcacctggaaaattgctcccgca
ctgtgctgtggtaacactgtggtcatcaagcctgcagagcagacaccactcagtgcactg
tatatgggagccctcatcaaggaggctggctttccacccggggtcgtcaacattctgcca
gggtatgggccaacagcaggggcagcaatagcgtctcacattggcatagacaagattgca
ttcacaggctctactgaggttggaaagcttattcaagaagcagctggaagaagtaatttg
aagagagtaactctggaacttggagggaaaagccctaatattatttttgcagatgctgac
ttggactacgctgtggagcaggctcaccagggtgtgttcttcaaccaaggccagtgctgc
actgcggggtctcgaatctttgtggaggagtccatctatgaggaatttgtgaaaagaagt
gtggaaagagccaagaggcgcattgtggggagcccctttgatcccactactgagcagggt
cctcagattgataagaagcaatacaacaaaatcctggagctcatccagagcggtgtggcc
gagggcgccaagctcgagtgtggaggcaaaggactgggaaggaagggcttcttcattgag
cctaccgtgttctccaacgttacagatgacatgcggatcgccaaggaggagatctttggt
cctgtccaggaaattttgaggtttaagactatggatgaagttatagaaagagccaataac
tcagacttcgggcttgtagcggctgtcttcactaatgacatcaacaaggctctcatggtg
tcctctgcaatgcaagctgggacagtttggatcaattgttacaacgccttaaatgctcag
agccccttcggggggttcaagatgtctggaaatgggagagaaatgggtgagtttggctta
cgggagtactcagaagtaaagaccgtgacggtgaagatcccccagaagaactcctaa

DBGET integrated database retrieval system