KEGG   Rattus norvegicus (rat): 116677
Entry
116677            CDS       T01003                                 

Gene name
F2rl1, Par-2, Par2
Definition
(RefSeq) F2R like trypsin receptor 1
  KO
K04234  coagulation factor II (thrombin) receptor-like 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04750  Inflammatory mediator regulation of TRP channels
rno05143  African trypanosomiasis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    116677 (F2rl1)
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    116677 (F2rl1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05143 African trypanosomiasis
    116677 (F2rl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    116677 (F2rl1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Thrombin
    116677 (F2rl1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srw 7TM_GPCR_Sru
Other DBs
NCBI-GeneID: 116677
NCBI-ProteinID: NP_446349
RGD: 620866
Ensembl: ENSRNOG00000018003
UniProt: Q63645
Position
2q12
AA seq 397 aa
MRSLSLAWLLGGITLLAASASCNRTVNAPGPNSKGRSLIGRLDTPPPITGKGAPVEPGFS
VDEFSASVLTGKLTTVFLPVIYIIVFVIGLPSNGMALWVFFFRTKKKHPAVIYMANLALA
DLLSVIWFPLKISYHLHGNDWTYGDALCKVLIGFFYGNMYCSILFMTCLSVQRYWVIVNP
MGHSRKRANIAVGVSLAIWLLIFLVTIPLYVMRQTIYIPALNITTCHDVLPEEVLVGDMF
SYFLSLAIGVFLFPALLTASAYVLMIKTLRSSAMDEHSEKKRRRAIRLIITVLSMYFICF
APSNVLLVVHYFLIKSQRQSHVYALYLVALCLSTLNSCIDPFVYYFVSKDFRDQARNALL
CRSVRTVKRMQISLTSNKFSRKSSSYSSSSTSVKTSY
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgcgaagtctcagcctggcgtggctgctgggaggtatcacccttctggcggcctcggcc
tcctgcaaccggaccgtgaatgcaccgggacccaacagtaaagggagaagtctgattggc
agattggacacgccgcctcccatcactgggaaaggggctccagttgaaccaggcttttcc
gttgatgaattctctgcatccgtcctcaccgggaagctgaccaccgtctttctcccggtc
atctacatcattgtctttgtaattggtttgcccagtaatggtatggccctctgggtcttc
ttcttccgaacgaagaagaagcaccctgctgtgatttacatggccaacctggccttggca
gacctcctctctgtcatctggttccccctgaagatctcctaccacctccatggcaacgac
tggacctatggggatgcgctctgcaaggtgctcattggctttttctacggcaatatgtac
tgctccatccttttcatgacctgcctcagcgtgcagaggtactgggtgatcgtgaacccc
atgggacactccaggaagagggccaacatcgctgttggcgtctccctggccatctggctc
ctgatttttctggtcaccatccctctgtacgtcatgaggcagaccatctacattccagcc
ttgaacatcaccacctgtcacgacgtgctgcccgaggaggtcctggtgggggacatgttc
agttacttcctctccctggccattggagtctttctgttcccagccctccttactgcgtct
gcctacgtgctcatgatcaaaacgctccgttcctccgccatggacgagcactcggagaag
aaaaggcggagggctatccgcctcatcatcacggtgctgtccatgtacttcatctgcttc
gctcccagcaacgtgctgctcgtcgtgcattatttcctcatcaaaagccagaggcagagc
cacgtctacgccctctacctcgtcgccctctgcctgtccaccctcaacagctgcatagac
ccctttgtctactactttgtttcgaaagatttcagggaccaggccagaaacgcgctcctc
tgccgaagcgtccgcaccgtgaaacgcatgcagatatcgctcacctccaacaagttctcc
aggaaatccagctcttactcctccagctcaaccagtgttaaaacctcctactga

DBGET integrated database retrieval system