KEGG   Rattus norvegicus (rat): 116684
Entry
116684            CDS       T01003                                 

Gene name
Oplah
Definition
(RefSeq) 5-oxoprolinase
  KO
K01469  5-oxoprolinase (ATP-hydrolysing) [EC:3.5.2.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    116684 (Oplah)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.9  5-oxoprolinase (ATP-hydrolysing)
     116684 (Oplah)
SSDB
Motif
Pfam: Hydantoinase_B Hydantoinase_A Hydant_A_N Hydant_A_C DUF896
Other DBs
NCBI-GeneID: 116684
NCBI-ProteinID: NP_446356
RGD: 620956
Ensembl: ENSRNOG00000011781
UniProt: P97608
Position
7
AA seq 1288 aa
MGSPEGRFHFAIDRGGTFTDVFAQCPGGHVRVLKLLSEDPANYPDAPTEGIRRILEQEEG
VLLPRGRPLDTSRIASIRMGTTVATNALLERQGERVALLVTRGFRDLLHIGTQARPDLFD
LAVPMPEVLYEEVLEVDERVVLYRGEPGAGSPVKGRTGDLLEIQQPVDLEALRGKLEGLL
SRGIHSLAVVLMHSYTWAQHEQQVGTLARELGFTHVSLSSEVMPMVRIVPRGHTACADAY
LTPTIQRYVQGFRRGFQGQLKNVQVLFMRSDGGLAPMDAFSGSRAVLSGPAGGVVGYSAT
TYHLEGGQPVIGFDMGGTSTDVSRYAGEFEHVFEASTAGVTLQAPQLDINTVAAGGGSRL
FFRSGLFVVGPESAGAHPGPACYRKGGPVTVTDANLVLGRLLPASFPCIFGPGEDQPLSP
EASRKALEAVAMEVNSFLTNGPCPASQLSLEEVAMGFVRVANEAMCRPIRALTQARGHDP
SAHVLACFGGAGGQHACAIARALGMDTVHIHRHSGLLSALGLALADVVHEAQEPCSLSYT
PETFAQLDQRLSRLEEQCVDALQVQGFPRSQISTESFLHLRYQGTDCALMVSAHQHPATA
CSPRAGDFGAAFVERYMREFGFIIPERPVVVDDVRVRGTGRSGLQLEDTPKIQTGPPHVE
KVTQCYFEGGYQETPVYLLGELGYGHQLQGPCLIIDNNSTILVEPGCQAEVTDTGDIRIS
VGAEGPSMADTRLDPIQLSIFSHRFMSIAEQMGRILQRTAISTNIKERLDFSCALFGPDG
GLVSNAPHIPVHLGAMQETVQFQIQHLGADLHPGDVLLSNHPSAGGSHLPDLTVITPVFW
PGQTRPVFYVASRGHHADIGGITPGSMPPHSTTLQQEGAVFLSFKLVQGGVFQEEAVTEA
LRAPGKISGCSGTRNLHDNLSDLRAQVAANQKGIQLVGELIGQYGLDVVQAYMGHIQANA
ELAVRDMLRAFGTSRQARGLPLEVSAEDHMDDGSPICLRVQINLSQGSAVFDFTGSGSEV
FGNLNAPRAITLSALIYCLRCLVGRDIPLNQGCLAPVRVIIPKGSILDPSPEAAVVGGNV
LTSQRVVDVILGAFGACSASQGCMNNVTLGNARMGYYETVAGGAGAGPGWHGRSGVHSHM
TNTRITDPEILESRYPVILRRFELRPGSGGRGRFRGGDGVVRELVFREEALLSVLTERRA
FQPYGLHGGEPGARGLNLLIRKDGRTVNLGGKTSVTVYPGDVFCLHTPGGGGYGDPEDPA
PPPGSPPLFPAFPERGSVFEYRRAQEAV
NT seq 3867 nt   +upstreamnt  +downstreamnt
atgggcagcccagaagggcgcttccatttcgccatcgaccgcggtggcaccttcacagat
gtctttgcccagtgccctggagggcatgtgcgtgtcctgaagctgctctcagaggaccct
gccaactatccagatgcacccacagagggcatccgccgaattctagagcaggaggagggt
gtgctgctgcctcgaggccgaccgctagacaccagtcgcattgccagcatccgcatgggt
accacggtggccaccaatgcactgttggaacgacagggagaacgggtggcactgctggtg
actcggggtttccgagacctgctgcatattggcactcaggcccgcccggacctctttgac
ttggctgtgcccatgccagaggttctgtatgaggaagtgctggaggtagatgagcgagtg
gtgctgtatcgcggagaaccaggtgccggctctcctgtcaaaggccgcacaggggacctg
ctagagatacagcagcctgtggacctggaagccctgcgtgggaagctggaggggctcttg
tctcggggcattcacagtctggcagtggtgctcatgcattcgtacacgtgggcccagcat
gagcagcaggtgggcacgctggcccgggagctgggcttcacgcacgtctccttgtcctcg
gaagtcatgcccatggtacgaattgttcctcggggccatacagcctgtgctgacgcttac
cttactcccaccatccagcgctatgtgcagggcttccgccgaggcttccagggccagcta
aagaatgtgcaagttctcttcatgcgctctgatggtggcctcgcacccatggatgctttc
agtggttcccgggctgtgctctctggccctgctgggggtgtggttggctactcagctacc
acctaccatctggaaggcggtcagcctgtcattggctttgacatgggaggcacatccaca
gacgtgagccgctatgctggagaatttgagcatgtctttgaggctagcacagcaggcgtt
acccttcaggcaccccagttggacatcaacacagtggcagctggcgggggttcccgcctc
ttcttcagatctggcctctttgtggttggtccagagtcagcaggtgcccacccaggtcct
gcctgctaccgtaaagggggtcctgtgacagtgacagatgctaatctggtcctgggtcgc
ctgctgcctgcctccttcccctgcatttttgggccaggagaagaccagccactgtctcct
gaggcttcccgaaaggctctagaggctgtggccatggaggtcaacagtttcttgaccaat
ggaccgtgcccagcttcccaactaagtctggaagaggtggccatggggtttgtgcgtgtt
gccaatgaagccatgtgccggcctatccgtgccctcacacaggcacgaggccatgacccc
tcagcccatgtattggcttgctttggaggagctggtgggcaacacgcttgtgccattgcc
cgggccctggggatggatactgtgcacattcacaggcacagcgggctgctgtcagcacta
ggactggccttggcagatgtggttcacgaagcacaggagccctgttccctgtcttacaca
cctgaaacctttgcacaactggaccagagactgagccgcctggaggagcagtgtgtggat
gccttgcaggtccagggcttccctaggtctcagatcagcaccgagagcttcctgcatctt
cgctaccaaggcactgactgcgccctaatggtgtctgcccatcagcatccggccacagcc
tgctcaccccgagctggtgactttggagccgcatttgtggagaggtacatgagagagttt
ggcttcattatccccgagcggccggtggtggtagatgatgtacgtgtgaggggaactggc
cgtagtggacttcagctggaggacacccccaaaatccagactggacctccccacgtggaa
aaggtgacccagtgctactttgaagggggttatcaggagactcccgtgtaccttttagga
gaactaggctacgggcaccagctccaagggccctgccttatcatcgacaacaacagcacc
atccttgtagaaccgggttgccaagcagaggtgactgatacaggggacatccgcatttct
gtgggagctgagggtcctagtatggcagataccaggcttgaccccatccagctgtctatt
ttctcacaccgcttcatgagcattgctgagcagatgggccgcatcctacagcgcacagcc
atctctaccaacatcaaggaacgcctcgacttctcctgtgccctctttgggccagatggg
ggcctcgtctccaatgctccccacattcctgtgcacctgggtgccatgcaagagactgta
cagttccagattcagcacttaggagccgacctccatcctggtgatgtgttgctcagcaac
catcccagcgcagggggcagccatcttcctgacctgactgtcattacaccggtgttttgg
ccaggccagacgaggcctgtgttctacgtggctagccgagggcaccacgcagacattgga
ggaatcacaccgggctctatgccgcctcactccaccacgctgcaacaggagggtgccgtt
tttctgtccttcaaactggtccagggaggcgtcttccaggaagaggcagtgacagaggcc
ctacgggcaccaggcaagatctctggctgtagtggaaccaggaacctgcatgacaacctg
tcggatcttcgtgcccaggtggcagctaaccagaaaggcatccagctggtgggagagctg
atcggacagtatggcttagatgtggtgcaggcctatatgggccatattcaggcgaatgct
gagctagcagtgagagacatgctccgggcttttggaacttcccggcaggccaggggcctg
cccctggaggtgtctgcagaggatcacatggatgatggctctcccatctgtctgcgtgtt
cagatcaacctgagtcagggcagtgcggtatttgactttactggttccgggtctgaggtg
tttggcaatctcaatgccccgagagccataacactgtctgctctcatctattgcttacgc
tgtctagtgggccgtgacatcccacttaaccagggttgcctggctcctgtgcgtgtcata
attcccaaaggctccatattggatccatccccagaggcagcagtggtcggcggcaacgtg
ctcacatctcagcgagtagtggatgtcattctgggggcttttggggcctgttcagcctcc
cagggctgcatgaacaatgtgaccctgggcaatgcccgtatgggctactatgagacagtg
gctggtggtgccggtgcgggccctggctggcatgggcgcagtggtgtacacagtcacatg
accaacacacgcattacggatccagagattctggagagtcggtatccagttatcctgcgc
cgctttgagctgaggccaggctccgggggccgaggtcgcttccggggaggtgatggcgta
gtccgagagctggtctttcgggaagaggcgctgttgtctgtgctcaccgagcgccgggcc
ttccagccttacggcctccacgggggagagcctggtgcgcgtggcttaaacctcctgatc
agaaaagatgggcgcacagtgaatttgggcggcaagacatctgtgaccgtgtaccccggg
gacgtgttctgcctccacacgcctgggggtgggggctacggagacccggaggatccagcg
ccaccaccaggctcgcccccgctatttccagccttccccgagcgcggcagtgtattcgag
taccgccgcgcccaggaagccgtatga

DBGET integrated database retrieval system