KEGG   Rattus norvegicus (rat): 116686Help
Entry
116686            CDS       T01003                                 

Gene name
Gsr
Definition
(RefSeq) glutathione-disulfide reductase
  KO
K00383  glutathione reductase (NADPH) [EC:1.8.1.7]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
rno04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    116686 (Gsr)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    116686 (Gsr)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.7  glutathione-disulfide reductase
     116686 (Gsr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 K_oxygenase FAD_binding_2
Motif
Other DBs
NCBI-GeneID: 116686
NCBI-ProteinID: NP_446358
RGD: 621747
Ensembl: ENSRNOG00000014915
UniProt: F1LRE1
Position
16q12.3
AA seq 410 aa AA seqDB search
MWNTAVHSEFIHDHVDYGFQNCKSKFNWHVIKEKRDAYVSRLNNIYQNNLTKSHIEVIHG
YATFADGPQPTVEVNGKKFTAPHILIATGGVPTVPHENQIPGASLGITSDGFFQLEDLPS
RSVIVGAGYIAVEIAGILSALGSKTSLMIRHDKVLRSFDSLISSNCTEELENAGVEVLKF
SQVKEVKKTPSGLELHVVTALPGRKPTVTTIPDVDCLLWAIGRDPNSKGLNLNKLGIQTD
DKGHILVDEFQNTNVKGVYAVGDVCGKALLTPVAIAAGRKLAHRLFEGKEDSRLDYDNIP
TVVFSHPPIGTVGLTEDEAVHKYGKDNVKIYSTAFTPMYHAVTTRKTKCVMKMVCANKEE
KVVGIHMQGIGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtggaacacagccgtgcactcggaattcatacatgatcacgtggattacggctttcaa
aactgcaagagtaaattcaattggcatgtcatcaaggagaagcgggatgcttacgtgagc
cgcctgaacaacatctaccaaaacaatttaaccaagtcccacatcgaagtcatccacggc
tacgcaacatttgcagatggtccccagcccacagtggaagtcaacgggaaaaagttcact
gctccacacatcctgatcgccacgggtggtgtgcccacggttcctcatgagaaccagatc
ccaggtgccagcctggggataaccagtgatgggttctttcagctggaagacttgcccagc
cgcagcgttattgtgggtgccggttacattgccgtggagattgcgggcatcctctccgcc
ctgggctccaagacgtctcttatgatcaggcatgataaggtgcttagaagctttgattca
ctcatcagttccaactgcaccgaggagctggagaacgctggcgtggaggtgttgaagttc
tcacaggttaaggaagtaaagaagaccccatcgggcttggaactccatgtggttactgca
cttcccggtaggaaacccaccgtgaccacgattccagatgtcgattgcctgctctgggcc
attggacgggacccaaattctaagggcctgaatctaaataaactggggattcagactgat
gacaaaggccatatcctagtggacgagttccagaataccaatgtcaaaggcgtctatgcc
gtgggcgatgtctgtgggaaagcacttctcaccccagttgcgatcgctgctggccggaaa
ctcgcccatagactttttgagggcaaagaagattccaggttggactatgacaacatccct
accgtggtcttcagccacccgcctatcgggacagtggggctcactgaagatgaagccgtc
cataagtatggcaaagacaatgtgaaaatctactcgaccgccttcaccccgatgtatcac
gctgtgaccacgaggaagacgaaatgcgtgatgaagatggtttgtgccaacaaagaggag
aaggtggttggcatccatatgcaggggattggctgcgatgagatgcttcagggcttcgct
gtagcagtgaaaatgggggccaccaaggccgacttcgacaatacggtcgccattcatcct
acctcttcagaagagctggtcacactgcgctga

DBGET integrated database retrieval system