KEGG   Rattus norvegicus (rat): 116686
Entry
116686            CDS       T01003                                 

Gene name
Gsr
Definition
(RefSeq) glutathione reductase
  KO
K00383  glutathione reductase (NADPH) [EC:1.8.1.7]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
rno04918  Thyroid hormone synthesis
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    116686 (Gsr)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    116686 (Gsr)
 09160 Human Diseases
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    116686 (Gsr)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.7  glutathione-disulfide reductase
     116686 (Gsr)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 K_oxygenase FAD_binding_2
Other DBs
NCBI-GeneID: 116686
NCBI-ProteinID: NP_446358
RGD: 621747
Ensembl: ENSRNOG00000014915
UniProt: F1LRE1
Position
16
AA seq 410 aa
MWNTAVHSEFIHDHVDYGFQNCKSKFNWHVIKEKRDAYVSRLNNIYQNNLTKSHIEVIHG
YATFADGPQPTVEVNGKKFTAPHILIATGGVPTVPHENQIPGASLGITSDGFFQLEDLPS
RSVIVGAGYIAVEIAGILSALGSKTSLMIRHDKVLRSFDSLISSNCTEELENAGVEVLKF
SQVKEVKKTPSGLELHVVTALPGRKPTVTTIPDVDCLLWAIGRDPNSKGLNLNKLGIQTD
DKGHILVDEFQNTNVKGVYAVGDVCGKALLTPVAIAAGRKLAHRLFEGKEDSRLDYDNIP
TVVFSHPPIGTVGLTEDEAVHKYGKDNVKIYSTAFTPMYHAVTTRKTKCVMKMVCANKEE
KVVGIHMQGIGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgtggaacacagccgtgcactcggaattcatacatgatcacgtggattacggctttcaa
aactgcaagagtaaattcaattggcatgtcatcaaggagaagcgggatgcttacgtgagc
cgcctgaacaacatctaccaaaacaatttaaccaagtcccacatcgaagtcatccacggc
tacgcaacatttgcagatggtccccagcccacagtggaagtcaacgggaaaaagttcact
gctccacacatcctgatcgccacgggtggtgtgcccacggttcctcatgagaaccagatc
ccaggtgccagcctggggataaccagtgatgggttctttcagctggaagacttgcccagc
cgcagcgttattgtgggtgccggttacattgccgtggagattgcgggcatcctctccgcc
ctgggctccaagacgtctcttatgatcaggcatgataaggtgcttagaagctttgattca
ctcatcagttccaactgcaccgaggagctggagaacgctggcgtggaggtgttgaagttc
tcacaggttaaggaagtaaagaagaccccatcgggcttggaactccatgtggttactgca
cttcccggtaggaaacccaccgtgaccacgattccagatgtcgattgcctgctctgggcc
attggacgggacccaaattctaagggcctgaatctaaataaactggggattcagactgat
gacaaaggccatatcctagtggacgagttccagaataccaatgtcaaaggcgtctatgcc
gtgggcgatgtctgtgggaaagcacttctcaccccagttgcgatcgctgctggccggaaa
ctcgcccatagactttttgagggcaaagaagattccaggttggactatgacaacatccct
accgtggtcttcagccacccgcctatcgggacagtggggctcactgaagatgaagccgtc
cataagtatggcaaagacaatgtgaaaatctactcgaccgccttcaccccgatgtatcac
gctgtgaccacgaggaagacgaaatgcgtgatgaagatggtttgtgccaacaaagaggag
aaggtggttggcatccatatgcaggggattggctgcgatgagatgcttcagggcttcgct
gtagcagtgaaaatgggggccaccaaggccgacttcgacaatacggtcgccattcatcct
acctcttcagaagagctggtcacactgcgctga

DBGET integrated database retrieval system