KEGG   Rattus norvegicus (rat): 116687Help
Entry
116687            CDS       T01003                                 

Gene name
Dnase1l3
Definition
(RefSeq) deoxyribonuclease 1-like 3
  KO
K11995  deoxyribonuclease-1-like protein [EC:3.1.21.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    116687 (Dnase1l3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     116687 (Dnase1l3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exo_endo_phos Exo_endo_phos_2
Motif
Other DBs
NCBI-GeneID: 116687
NCBI-ProteinID: NP_446359
RGD: 620669
Ensembl: ENSRNOG00000009291
UniProt: O89107
Position
15p14
AA seq 310 aa AA seqDB search
MSLYPASPYLASLLLFILALHGALSLRLCSFNVRSFGESKKENHNAMDIIVKIIKRCDLI
LLMEIKDSNNNICPMLMEKLNGNSRRSTTYNYVISSRLGRNTYKEQYAFLYKEKLVSVKA
KYLYHDYQDGDTDVFSREPFVVWFQAPFTAAKDFVIVPLHTTPETSVKEIDELADVYTDV
RRRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPNFVWLIGDQEDTTVKKSTSCAYDR
IVLRGQEIVNSVVPRSSGVFDFQKAYELSEEEALDVSDHFPVEFKLQSSRAFTNSRKSVS
LKKKKKGSRS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgtacccagcttccccatacctggcctccctgctactcttcatccttgccctt
catggtgccctgtccctgaggctctgctccttcaatgtgaggtcctttggagagagcaag
aaggaaaaccacaatgccatggatatcattgtgaagatcatcaaacgctgcgacctcata
ctgctgatggaaatcaaggacagcaacaacaacatctgtcccatgctgatggagaagctg
aatggaaactcacgaagaagcacgacatacaactacgtgattagctctcggcttggaaga
aacacatataaagaacagtatgccttcctctacaaggagaagctggtgtctgtgaaggca
aaatacctctaccatgactatcaggatggagacacagacgtgttttccagggagcccttt
gtggtttggttccaggcgcccttcactgctgccaaggacttcgtgattgtccccttgcac
acaactcctgaaacctccgttaaagagatagatgagctggctgacgtctacacggatgtg
agaagacgatggaaggcagagaatttcatcttcatgggtgatttcaatgctggctgcagc
tacgtccccaagaaggcctggaagaacatccgtttgaggacagaccccaactttgtttgg
ctgattggggaccaagaggacaccacggtcaagaagagcaccagctgtgcctatgacagg
attgtgcttcgcggacaagagatagtcaactctgtggttccccgctccagtggcgtcttt
gactttcagaaagcttatgagttgtctgaagaggaggccctggatgtcagtgaccacttt
ccagttgagtttaagctacagagttcaagagccttcaccaacagccgaaaatctgtttct
ctaaagaaaaagaaaaaaggcagtcgctcctag

DBGET integrated database retrieval system