KEGG   Rattus norvegicus (rat): 116689Help
Entry
116689            CDS       T01003                                 

Gene name
Ptpn6, Ptph6, Shp-1
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 6
  KO
K05697  tyrosine-protein phosphatase non-receptor type 6 [EC:3.1.3.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04520  Adherens junction
rno04630  Jak-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno05140  Leishmaniasis
rno05205  Proteoglycans in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    116689 (Ptpn6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    116689 (Ptpn6)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    116689 (Ptpn6)
   04660 T cell receptor signaling pathway
    116689 (Ptpn6)
   04662 B cell receptor signaling pathway
    116689 (Ptpn6)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    116689 (Ptpn6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    116689 (Ptpn6)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    116689 (Ptpn6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    116689 (Ptpn6)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     116689 (Ptpn6)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    116689 (Ptpn6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase SH2 DSPc PTPlike_phytase Y_phosphatase3 HGAL
Motif
Other DBs
NCBI-GeneID: 116689
NCBI-ProteinID: NP_446360
RGD: 620660
Ensembl: ENSRNOG00000014294
UniProt: P81718
Position
4q42
AA seq 613 aa AA seqDB search
MLSRGWFHRDLSGPDAETLLKGRGVPGSFLARPSRKNQGDFSLSVRVDDQVTHIRIQNSG
DFYDLYGGEKFATSTELVEYYTQQQGILQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGG
QAESLLQAKGEPWTFLVRESLSQPGDFVLSVLNDQPKAAPGSPLRVTHIKVMCEGGRYTV
GGSETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESED
TAKAGFWEEFESLQKQEAKNLHQRLEGQRPENKSKNRYKNILPFDHSRVILQGRDSNIPG
SDYINANYVKNQLLGPDENSKTYIASQGCLDATVNDFWQMAWQENTRVIVMTTREVEKGR
NKCVPYWPEVGTQRVYGLYSVTNCKEHDTAEYKLRTLQISPLDNGDLVREIWHYQYLSWP
DHGVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMESVSTKGL
DCDIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEIIQSQRGQESEYGN
ITYPPALRSAHAKASRTSSKHKEEVYENVHSKNKKEEKVKKQRSADKEKNKGSLKRNISL
TPCRGLRWADRDL
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcccgcgggtggtttcaccgggacctcagtgggcctgatgccgagaccctgctc
aagggccggggagtccctgggagcttcctggctcggcccagtcgcaagaaccagggtgac
ttctccctctcagtcagggtggatgaccaggtgactcatattcggatccagaactcaggg
gacttctatgacctgtatggaggggagaagtttgcgacgtcgacagagctggtggagtat
tacactcagcagcagggcatcctgcaggaccgagacggcaccatcatccacctcaagtac
ccactgaactgctcggaccccaccagcgagaggtggtatcatggtcacatgtctggaggg
caggcagagtcactgctgcaggccaagggcgagccctggacatttcttgtgcgtgagagt
ctcagccaacctggtgattttgtgctctctgtgctcaatgaccagcccaaggctgccccg
ggttccccgctcagggtcacgcacatcaaggttatgtgtgagggtggacgatacactgtg
ggtggctcagagacattcgacagcctcacagacctggtggagcacttcaagaagacgggg
attgaggaggcctcaggtgcctttgtctacctgaggcagccttactatgccactcgggta
aatgcagcagacattgagaaccgggtcttggaactgaacaagaagcaggagtcagaggac
acagccaaggccggcttctgggaggagtttgagagtctgcaaaagcaagaggcaaagaac
ttgcaccagcgtctggaagggcagcggccggagaacaagagcaagaaccgctacaagaac
attcttccctttgaccacagccgagtgatcctgcagggacgtgacagtaacatcccaggg
tctgattacatcaatgccaactacgttaagaaccagctgctaggtccggatgagaactct
aagacctacatcgccagtcagggctgtctggacgctaccgtcaatgacttctggcagatg
gcttggcaggagaacactcgtgtcatcgtcatgactaccagagaggtggagaaaggccgg
aacaaatgtgtcccatactggcctgaggtgggcactcagcgcgtctatgggctctactct
gtgaccaactgtaaagagcatgacacagcagagtacaaacttcgaacattgcagatctcc
ccactggacaatggggacctggttcgggagatatggcactaccagtacctgagctggcct
gaccatggggttcccagtgagcctggaggtgtcctcagctttctggatcagatcaaccag
cggcaggaaagtttgcctcacgcggggcccatcattgtgcattgcagcgctggcatcggc
cgcaccggcaccatcatcgtcattgatatgctcatggagagcgtctccaccaaggggcta
gactgtgacattgacatccagaagaccatccagatggtacgggcacagcgctctggcatg
gtgcagacagaggcacagtacaagtttatttatgtggccatcgcccagttcatcgaaaca
accaagaagaaactggagatcatacaatcccagaggggccaggagtcggagtatgggaac
atcacctaccctccggctttgaggagtgcccacgccaaagcctcccgtacctcgtccaaa
cacaaggaggaggtgtacgaaaacgtgcatagcaagaacaagaaggaagagaaagtaaag
aagcagcgatcggcagacaaggagaagaacaaaggttctctcaagaggaacatcagcctt
actccgtgcagaggcctccgctgggcagacagagacctgtag

DBGET integrated database retrieval system