KEGG   Rattus norvegicus (rat): 116690Help
Entry
116690            CDS       T01003                                 

Gene name
Nfasc, NF
Definition
(RefSeq) neurofascin
  KO
K06757  neurofascin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    116690 (Nfasc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 I-set Ig_2 ig fn3 Bravo_FIGEY V-set Ig_5 Ig_6 C2-set_2 BiPBP_C
Motif
Other DBs
NCBI-GeneID: 116690
NCBI-ProteinID: NP_001153786
RGD: 620911
Ensembl: ENSRNOG00000030515
UniProt: P97685
Position
13q13
AA seq 1240 aa AA seqDB search
MARQQAPPWVHVALILFLLSLGGAIEIPMDPSIQNELTQPPTITKQSVKDHIVDPRDNIL
IECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRSGTLVIDFRSGGRPEEYEGEYQCFA
RNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVA
ERTPSFMYPQGTSSSQMVLRGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKA
LRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWLVNGDPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLAN
AFVSVLDVPPRMLSPRNQLIRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHV
YENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVAKRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCMASTELDQ
DLAKAYLTVLADQATPTNRLAALPKGRPDRPRDLELTDLAERSVRLTWIPGDDNNSPITD
YVVQFEEDQFQPGVWHDHSKFPGSVNSAVLHLSPYVNYQFRVIAVNEVGSSHPSLPSERY
RTSGAPPESNPSDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETRETWNNVT
VWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPETVIGYSGEDLPSAPRRFRVRQPNLET
INLEWDHPEHPNGILIGYTLRYVPFNGTKLGKQMVENFSPNQTKFSVQRADPVSRYRFSL
SARTQVGSGEAATEESPTPPNEATPTAAPPTLPPTTVGTTGLVSSTDATALAATSEATTV
PIIPTVVPTTVATTIATTTTTTAAATTTTTTESPPTTTTGTKIHETAPDEQSIWNVTVLP
NSKWANITWKHNFRPGTDFVVEYIDSNHTKKTVPVKAQAQPIQLTDLFPGMTYTLRVYSR
DNEGISSTVITFMTSTAYTNNQTDIATQGWFIGLMCAIALLVLILLIVCFIKRSRGGKYP
VREKKDVPLGPEDPKEEDGSFDYSDEDNKPLQGSQTSLDGTIKQQESDDSLVDYGEGGEG
QFNEDGSFIGQYTVRKDKEETEGNESSEATSPVNAIYSLA
NT seq 3723 nt NT seq  +upstreamnt  +downstreamnt
atggccaggcagcaggcgccaccctgggtccacgtagccctcatcctcttcctcctcagc
ctcggaggggccattgagattccgatggatccaagcattcagaatgagctgacccaaccc
ccaacgatcaccaagcagtcggtgaaggaccacatcgtggacccccgagataacatcctg
attgaatgtgaagctaaagggaaccccgcccccagtttccactggactcgcaacagcagg
ttcttcaacattgccaaggacccacgggtgtccatgaggaggaggtctgggaccttggtg
atcgacttccgcagtggtgggcggcctgaggagtacgaaggggagtaccagtgctttgcc
cggaacaaattcggcacagctcttagcaaccgcatccgcctgcaggtgtccaaatctccc
ctgtggcccaaggaaaacctagaccccgtcgtggttcaagagggtgcccccttaaccctg
cagtgcaaccccccacctggcctcccatcccccgtcatcttctggatgagcagctccatg
gagcccatcacccaggacaagcgtgtctcccagggtcacaacggggacctgtacttctcc
aacgtcatgctgcaggacatgcagaccgactacagctgcaatgcacgcttccacttcacc
cacaccattcagcagaagaatcccttcaccctcaaagtcctcaccacccgaggagttgcg
gaaagaacacctagcttcatgtatccccagggcacgtcaagcagtcagatggtactgcgc
ggcatggacctgctgctggagtgcattgcctctggggtcccaacaccagatattgcatgg
tacaagaaaggtggggacctcccatctgacaaggccaagttcgagaattttaacaaggct
ctgcgcatcaccaatgtctctgaagaggactctggggagtatttctgcctggcctccaac
aagatgggcagcatccggcacacgatctcggtgagagtaaaggctgccccatactggctg
gatgagcccaagaacttgatcctggctcctggtgaagatgggaggctggtgtgtcgagcc
aatgggaacccgaagccgaccgtccagtggctggtgaatggagaccctttgcaatcggca
ccacccaaccccaaccgtgaggtggccggagacactatcatcttccgggacactcagatc
agcagcagggcagtgtaccagtgtaacacatccaacgaacatggctacctgctggccaat
gccttcgtcagcgtattagatgtaccccctcggatgctgtctccccggaaccagctcatc
agggtgatcctttacaaccggacgcgactggactgtccgttctttgggtctcccattcca
acactccgatggtttaagaatgggcaaggaagcaacctggatggtggtaactaccacgtc
tacgaaaatggcagcctggaaatcaagatgattcgcaaagaggaccaaggcatctacacc
tgtgtggccaccaacatcctgggaaaagctgaaaatcaagtccgcctggaggtcaaagac
cccaccaggatctacaggatgcctgaagaccaggtggccaagaggggcaccacagtgcag
ctggagtgccgtgtgaagcatgacccctccttgaaactcacagtctcctggctgaaggat
gacgagccactctacattggaaacaggatgaaaaaggaagatgactccctgaccatcttc
ggagtggcagagcgggaccaaggcagttacacgtgcatggccagcaccgagctggaccag
gacctggcaaaggcctacctcactgttctagctgatcaggccactccgactaaccgtttg
gctgccctgcccaaagggcggccagaccgacccagggacctggagctcactgacctggcg
gaaaggagtgtgaggctgacctggatcccgggggatgataacaacagtcccatcacagac
tacgttgtccagtttgaagaggaccagttccagccaggagtctggcatgaccactccaag
ttcccaggcagtgtcaactcagccgtcctccatctgtccccgtatgtcaactatcagttc
cgagtcatcgctgtcaacgaggttgggagcagccaccccagccttccatccgagcggtac
cgaacaagcggggcaccccctgaatccaaccccagtgatgtgaagggcgaagggacacga
aaaaacaatatggagatcacatggacgcctatgaatgctacctccgcctttggccccaac
ctgcgctacattgtcaagtggcgacggagagaaacccgagagacttggaacaatgtcacc
gtgtggggctctcgctatgtggtggggcagacccctgtctacgtaccctatgagatccga
gtccaggctgaaaatgactttgggaaaggcccggagcctgaaaccgtcattgggtactcg
ggggaagatttacccagtgcccccaggcgtttcagagtccgacagcccaacctggagacc
atcaacctggaatgggatcacccagagcaccccaacgggatcctgattggatacacgctc
agatacgtgccctttaatggaaccaaactgggaaagcagatggtggaaaacttctctccc
aatcagaccaagttctcggtgcagagagcagaccccgtgtcccgttaccgcttctccctc
agtgccaggacgcaggtgggctctggagaagcagccacggaggagtccccaacacctcca
aatgaagctactccaactgcagctcctcccacattgcccccgactaccgtgggtaccaca
ggccttgtgagcagtactgatgctactgcccttgctgccaccagtgaagccacaacagtt
cccatcatcccaacggtggtacctaccaccgtcgccaccaccattgccacaactactaca
accactgccgccgccaccaccactaccaccacggagagtcctcccactaccaccactggg
actaagattcacgaaaccgcccccgacgagcagtccatttggaacgtcacggtgctcccc
aacagtaaatgggccaacatcacctggaagcacaatttcaggcctggaactgactttgtg
gttgagtacatcgacagcaaccatacgaaaaaaactgtccctgttaaggcccaagcccag
cccatacagctgacagacctctttcccgggatgacgtacacgttgcgggtgtattcccgg
gacaacgagggcatcagcagtaccgtcatcacctttatgaccagtacagcttacaccaac
aaccagactgacatcgccacccagggctggttcatcgggctcatgtgtgccattgccctt
ctggtgctgatcctgctgatcgtctgcttcatcaagaggagtcgtggcggcaagtaccca
gtgcgagaaaagaaggatgtccccttgggccctgaagaccccaaagaagaagatggttca
tttgactacagtgacgaggacaacaagcccctgcagggcagccagacatctctggacggc
accatcaagcagcaggagagtgacgacagcctagtggactacggcgagggtggcgagggc
cagttcaacgaagatggctcctttattggccagtacactgtcagaaaggacaaggaggag
accgagggcaatgagagctcagaggccacatctccagtcaatgccatctattccctggcc
tga

DBGET integrated database retrieval system