KEGG   Rattus norvegicus (rat): 116694Help
Entry
116694            CDS       T01003                                 

Gene name
Capn9, Ncl-4
Definition
(RefSeq) calpain 9
  KO
K08578  calpain-9 [EC:3.4.22.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    116694 (Capn9)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     116694 (Capn9)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C2: calpain family
   116694 (Capn9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_7 EF-hand_5
Motif
Other DBs
NCBI-GeneID: 116694
NCBI-ProteinID: NP_001258069
RGD: 70965
Ensembl: ENSRNOG00000018480
UniProt: O35920
Position
19q12
AA seq 690 aa AA seqDB search
MPYLHRSLRPQPQPVPRDARTVHSSGHSFEQLRQSCLQSGTLFEDADFPASNSSLFYSER
PQVPFVWKRPGEIVENPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALARVVPQD
QGFGSGYAGIFHFQFWQHSEWLDVVIDDRLPTFRDRLVFLHSADHNEFWSALLEKAYAKL
NGSYEALKGGSAIEAMEDFTGGVAENFQIREAPEDFYEILEKALRRGSLLGCSIDTLNAS
ESEARTPLGLIKGHAYTVTGLDQVNFHGQRIKLIRVRNPWGQVEWNGPWSDSSPEWRSMS
LEEQKRLGHTALDDGEFWMAFEDFKTHFDKVEICNLTPDALEDNTLHKWEVTIHQGSWVR
GSTAGGCRNFLDTFWTNPQIKLSLTERDEGQEGCTFLAALMQKDRRRLKRFGANMLTIGY
AIYQCPDKDGHLNRDFFRYHASLARSKTFINLREVSGRFQLPPGDYILIPSTFEPHQEAD
FCLRIFSEKKAVTQDLDENIDIDLPELPKPTPQEEETEEERQFRALFRRIAGEDMEVSAE
ELEYVLNAVLQKKTALKFKRLSLLSCRNIISLMDTSGNGKMEFEEFRVFWDKLRYWMDLF
LQFDVDKSGTMSSYELRTALKAAGFQLGSHLLQLIVLRYADENLQLDFDDYLNCLVRLEN
ASRVFQCLSVKNKDFIHLNINEFINLTMNI
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgccttacctgcatcggtccctgagaccccagccacagccagtccccagggatgccagg
actgtccactcctcgggccacagctttgagcagctgaggcaaagctgtctgcagtcgggc
accttgtttgaggatgctgacttccctgccagcaatagttcactgttctacagcgagagg
ccccaggtcccctttgtgtggaagcggccaggggaaattgtggaaaacccagaattcatt
ctgggaggggccaccaggaccgacatctgccaaggggaactgggagactgctggctcctg
gccgccattgcctccctaaccctcaatcagaaagcactggccagagtggtaccccaggac
caaggatttggttctggctatgctgggatatttcacttccagttctggcagcacagtgag
tggctggacgtggtgattgatgaccgcctgcctacctttcgggatcgcctggtcttcctc
cactctgccgaccacaatgagttctggagcgcactgctggagaaagcctatgccaagctg
aacgggagttacgaggcactgaaggggggcagcgccatcgaagccatggaggacttcacc
gggggtgtggctgagaacttccaaatccgagaggcaccagaggatttctacgagattctg
gagaaggccctgcggcgtggttccttgctgggctgctccatagataccctgaatgcctca
gaatctgaagcccgcacacctttgggcctcattaagggccatgcctacactgtgactgga
ctcgaccaggtaaacttccacggccagagaatcaagctcatcagagtccgtaacccttgg
ggccaggtggaatggaacgggccatggagcgacagctctcctgagtggcgctccatgagc
ctggaggagcagaagcgcctaggtcacaccgcccttgacgatggagaattctggatggca
tttgaggacttcaagacccattttgacaaagtggagatctgcaacctcacgcctgatgcc
ctggaggacaacaccctccacaagtgggaggtgaccatccaccaaggaagctgggttcgt
ggctccaccgccggcggctgccgcaacttcctggacaccttctggaccaacccacagata
aagctgtctctgacagagagggatgagggccaggagggctgcactttcctagcagccttg
atgcagaaagaccgcaggaggctcaagaggtttggtgccaacatgctgaccattggctat
gccatttaccagtgcccagacaaggacggacacctgaatagggactttttcaggtaccat
gcctctctggcccgaagtaagacattcatcaacttgagagaagtctcaggccgcttccag
ctgcccccgggagactatatcctcatccccagcacctttgagccacaccaggaggctgac
ttctgcctgagaatcttctctgagaagaaagctgttactcaggacctggatgagaacata
gacattgaccttcctgagcttccaaagccgacaccacaggaggaggaaaccgaagaggag
cggcagttccgggccctgttccgtcgaattgctggtgaggacatggaggtgtcagcagaa
gagcttgaatatgttctaaatgctgttctgcaaaagaaaacagccctcaagttcaagagg
ctgagcctgctttcctgcagaaacattatctccctgatggacaccagcggcaacgggaag
atggagttcgaagagttccgggtgttctgggacaagctgaggtactggatggacctgttt
ctccagttcgatgtggacaagtccggcaccatgtcttcctatgagttgcggacagcactg
aaagctgcaggctttcagctgggtagccatctcctgcagctgatcgtcctcaggtatgca
gacgagaacctccagctggatttcgatgactacctcaactgcctggtgcggctggagaat
gcgagccgggtgttccagtgtctcagtgtgaagaacaaggacttcatccatctcaacata
aacgagttcatcaacttgaccatgaacatctga

DBGET integrated database retrieval system