KEGG   Rattus norvegicus (rat): 116698Help
Entry
116698            CDS       T01003                                 

Gene name
Trim28, Kap1, Krip1, Tif1b
Definition
(RefSeq) tripartite motif-containing 28
  KO
K08882  tripartite motif-containing protein 28 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    116698 (Trim28)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    116698 (Trim28)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     116698 (Trim28)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  TIF1 family [OT]
   116698 (Trim28)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    116698 (Trim28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-B_box zf-RING_5 PHD zf-RING_UBOX zf-RING_2 zf-C3HC4 PHD_2
Motif
Other DBs
NCBI-GeneID: 116698
NCBI-ProteinID: NP_446368
RGD: 620289
Ensembl: ENSRNOG00000027487
UniProt: O08629
Position
1q12
AA seq 835 aa AA seqDB search
MAASAAAATAAASAATAASAASGSPGSGEGSAGGEKRPAASSAAAASASASSPAGGGGEA
QELLEHCGVCRERLRPERDPRLLPCLHSACSACLGPATPAAANNSGDGGSAGDGAMVDCP
VCKQQCYSKDIVENYFMRDSGSKASSDSQDANQCCTSCEDNAPATSYCVECSEPLCETCV
EAHQRVKYTKDHTVRSTGPAKTRDGERTVYCNVHKHEPLVLFCESCDTLTCRDCQLNAHK
DHQYQFLEDAVRNQRKLLASLVKRLGDKHATLQKNTKEVRSSIRQVSDVQKRVQVDVKMA
ILQIMKELNKRGRVLVNDAQKVTEGQQERLERQHWTMTKIQKHQEHILRFASWALESDNN
TALLLSKKLIYFQLHRALKMIVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERPGTNST
GPGPMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGTDDPYSSAEPHVSGMKRSRSGEGEVS
GLMRKVPRVSLERLDLDLTSDSQPPVFKVFPGSTTEDYNLIVIERGAAAAAAGQAGTVPP
GAPGAPPLPGMAIVKEEETEAAIGAPPAAPEGPETKPVLMALTEGPGAEGPRLASPSGST
SSGLEVVAPEVTSAPVSGPGILDDSATICRVCQKPGDLVMCNQCEFCFHLDCHLPSLQDV
PGEEWSCSLCHVLPDLKEEDGSLSLDGADSTGVVAKLSPANQRKCERVLLALFCHEPCRP
LHQLATDSTFSMEQPGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDK
ADVQSIIGLQRFFETRMNDAFGDTKFSAVLVEPPPLNLPSAGLSSQELSGPGDGP
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctcggcggcggcggcgactgcggcggcctcggccgcgacggccgcgtcagcg
gcctctggtagcccagggtcgggcgaaggctcggcgggcggtgagaagcgccccgctgcc
tcttcagccgcggcggcctcggcctccgcgtcgtcccctgcggggggcggtggcgaggcg
caggagcttttggagcactgcggcgtgtgtcgcgagcgcttgcggcctgagcgggatcct
cggctgctgccctgtctgcattcggcctgtagtgcctgccttggccccgctacacccgcc
gcagctaataattcgggggatggcggctcggcgggcgacggcgctatggtggattgtcca
gtgtgcaaacaacagtgctactccaaagacatcgtggagaattactttatgcgtgatagt
ggcagtaaggcctcttctgattcccaggatgctaaccagtgctgcactagctgtgaagat
aacgccccagccactagctattgtgtggagtgctctgaaccactgtgtgagacctgtgtg
gaggctcaccagcgggtgaaatacaccaaggatcacactgtgcgctccacgggtcctgct
aagactcgagatggagaacgaacagtctattgtaatgtgcacaagcatgaaccccttgtg
ctgttttgtgagagctgtgacacgctcacttgccgggactgccaactcaatgctcacaag
gaccaccagtaccaattcttggaagatgcagtaaggaaccaacgtaaactcttggcttca
ctggtgaaacgtcttggggacaaacatgccacactgcagaaaaacaccaaggaggttcga
agctcgatccgccaggtgtctgatgtgcagaagcgagtgcaggttgatgtgaagatggcc
attctgcagatcatgaaggagctgaataaacggggacgagttctggtcaatgatgcccag
aaggtgactgagggtcagcaggaacgtctggagcgtcagcactggaccatgaccaaaatc
cagaagcaccaggaacacattttgcgctttgcctcttgggctttggagagtgataacaat
acagccctcttgctctctaagaagctgatttatttccagctgcatcgggccctcaaaatg
attgtggatcctgtggagcctcatggtgagatgaagtttcagtgggatctcaatgcctgg
accaagagtgctgaagcctttggtaagattgtggctgagcgtcctggtacaaactccacg
ggtcctgggcccatggctcctccaagagccccaggccccctaagcaagcaaggttctggt
agtagccagcccatggaagtacaagagggctatggctttgggacagatgatccctactca
agtgcagagccacatgtatcaggcatgaagcggtcccgctctggtgagggagaagtaagt
ggcctcatgaggaaggtgccacgtgtgagccttgaacgcctggatctggatctcacctct
gatagccagccaccagtcttcaaggtctttcctggaagcaccactgaggactacaatcta
attgttattgagcgtggtgctgctgcagcagccgctggccaggctgggactgtgccacca
ggagcccctggtgccccacccctgcctggcatggccattgtcaaggaagaagagacagaa
gctgctattggagcccctcctgctgcccctgaggggcctgaaaccaagcctgtgttgatg
gctctgactgaaggccctggggctgagggacctcgtctagcttcacctagtggcagtacc
agctcaggcttggaggtggtagctcctgaggttacctcagccccagtaagtgggccaggt
atcctggatgacagtgccactatctgccgtgtatgccagaagccaggtgacctggtcatg
tgcaaccagtgcgagttttgcttccacctggattgtcacctcccttccctgcaggatgtt
ccaggggaggaatggagttgctcactctgccacgtgctccctgatctaaaggaggaagat
ggaagccttagcttggatggagcagatagcactggtgtggtagctaaactctcaccagcc
aaccagcggaaatgtgagcgtgttctgctggcccttttctgccatgaaccgtgccgcccc
ttgcatcagctggctaccgactctacattctccatggagcagcctggtggtaccctagac
ctgaccttgattcgtgctcgcctccaagagaagctgtcacctccttatagctccccccag
gagtttgcccaggatgtgggccgcatgttcaaacagttcaataagctgactgaggacaag
gcagatgttcagtccatcatcggcctccagcgcttctttgagacacgaatgaatgatgcc
tttggtgacaccaagttttctgctgtgctggtagaaccaccaccactgaaccttcccagt
gctggcctaagttctcaggagctgtctggtcctggtgatggcccctga

DBGET integrated database retrieval system