KEGG   Rattus norvegicus (rat): 116700Help
Entry
116700            CDS       T01003                                 

Gene name
Cga, Gpa1
Definition
(RefSeq) glycoprotein hormones, alpha polypeptide
  KO
K08522  glycoprotein hormones alpha chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
rno04917  Prolactin signaling pathway
rno04918  Thyroid hormone synthesis
rno04923  Regulation of lipolysis in adipocytes
rno04929  GnRH secretion
rno05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    116700 (Cga)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    116700 (Cga)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    116700 (Cga)
   04929 GnRH secretion
    116700 (Cga)
   04912 GnRH signaling pathway
    116700 (Cga)
   04913 Ovarian steroidogenesis
    116700 (Cga)
   04917 Prolactin signaling pathway
    116700 (Cga)
   04918 Thyroid hormone synthesis
    116700 (Cga)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    116700 (Cga)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_6 DUF1218
Motif
Other DBs
NCBI-GeneID: 116700
NCBI-ProteinID: NP_446370
RGD: 620436
Ensembl: ENSRNOG00000009269
UniProt: Q6P509
Position
5q21
AA seq 120 aa AA seqDB search
MDCYRRYAAVILVMLSMVLHILHPLPDGDLIIQGCPECKLKENKYFSKLGAPIYQCMGCC
FSRAYPTPARSKKTMLVPKNITSEATCCVAKSFTKATVMGNARVENHTDCHCSTCYYHKS
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggattgctacagaagatatgcggctgtcattctggtcatgctgtccatggtcctgcat
attcttcatcctcttcctgatggagaccttattattcagggttgtccagaatgtaaacta
aaggaaaacaaatacttctccaagctgggtgcccccatctatcagtgtatgggctgttgc
ttctccagggcatacccgactcccgcaaggtccaagaagacaatgttggttccaaagaat
attacctcggaggccacgtgctgtgtggccaaatcatttactaaggccacagtgatggga
aacgccagagtggagaaccacacggactgccactgtagcacttgttactaccacaagtcg
tag

DBGET integrated database retrieval system