KEGG   Rattus norvegicus (rat): 116700
Entry
116700            CDS       T01003                                 

Gene name
Cga
Definition
(RefSeq) glycoprotein hormones alpha chain precursor
  KO
K08522  glycoprotein hormones alpha chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
rno04917  Prolactin signaling pathway
rno04918  Thyroid hormone synthesis
rno04923  Regulation of lipolysis in adipocytes
rno04929  GnRH secretion
rno05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    116700 (Cga)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    116700 (Cga)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    116700 (Cga)
   04929 GnRH secretion
    116700 (Cga)
   04912 GnRH signaling pathway
    116700 (Cga)
   04913 Ovarian steroidogenesis
    116700 (Cga)
   04917 Prolactin signaling pathway
    116700 (Cga)
   04918 Thyroid hormone synthesis
    116700 (Cga)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    116700 (Cga)
SSDB
Motif
Pfam: Hormone_6 DUF1218
Other DBs
NCBI-GeneID: 116700
NCBI-ProteinID: NP_446370
RGD: 620436
Ensembl: ENSRNOG00000009269
UniProt: Q6P509
Position
5
AA seq 120 aa
MDCYRRYAAVILVMLSMVLHILHPLPDGDLIIQGCPECKLKENKYFSKLGAPIYQCMGCC
FSRAYPTPARSKKTMLVPKNITSEATCCVAKSFTKATVMGNARVENHTDCHCSTCYYHKS
NT seq 363 nt   +upstreamnt  +downstreamnt
atggattgctacagaagatatgcggctgtcattctggtcatgctgtccatggtcctgcat
attcttcatcctcttcctgatggagaccttattattcagggttgtccagaatgtaaacta
aaggaaaacaaatacttctccaagctgggtgcccccatctatcagtgtatgggctgttgc
ttctccagggcatacccgactcccgcaaggtccaagaagacaatgttggttccaaagaat
attacctcggaggccacgtgctgtgtggccaaatcatttactaaggccacagtgatggga
aacgccagagtggagaaccacacggactgccactgtagcacttgttactaccacaagtcg
tag

KEGG   Rattus norvegicus (rat): 25353
Entry
25353             CDS       T01003                                 

Gene name
Spp1
Definition
(RefSeq) osteopontin precursor
  KO
K06250  secreted phosphoprotein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04371  Apelin signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04620  Toll-like receptor signaling pathway
rno04929  GnRH secretion
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    25353 (Spp1)
   04151 PI3K-Akt signaling pathway
    25353 (Spp1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    25353 (Spp1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25353 (Spp1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    25353 (Spp1)
  09152 Endocrine system
   04929 GnRH secretion
    25353 (Spp1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    25353 (Spp1)
SSDB
Motif
Pfam: Osteopontin
Other DBs
NCBI-GeneID: 25353
NCBI-ProteinID: NP_037013
RGD: 3752
Ensembl: ENSRNOG00000043451
Vega: OTTRNOG00000000106
UniProt: P08721
Position
14
AA seq 317 aa
MRLAVVCFCLFGLASCLPVKVAEFGSSEEKAHYSKHSDAVATWLKPDPSQKQNLLAPQNS
VSSEETDDFKQETLPSNSNESHDHMDDDDDDDDDGDHAESEDSVNSDESDESHHSDESDE
SFTASTQADVLTPIAPTVDVPDGRGDSLAYGLRSKSRSFPVSDEQYPDATDEDLTSRMKS
QESDEAIKVIPVAQRLSVPSDQDSNGKTSHESSQLDEPSVETHSLEQSKEYKQRASHEST
EQSDAIDSAEKPDAIDSAERSDAIDSQASSKASLEHQSHEFHSHEDKLVLDPKSKEDDRY
LKFRISHELESSSSEVN
NT seq 954 nt   +upstreamnt  +downstreamnt
atgagactggcagtggtttgcttttgcctgttcggccttgcctcctgtctcccggtgaaa
gtggctgagtttggcagctcagaggagaaggcgcattacagcaaacactcagatgctgta
gccacttggctgaagcctgacccatctcagaagcagaatcttctagccccacagaattct
gtgtcctctgaagaaacggatgactttaagcaagaaactcttccaagcaactccaatgaa
agccatgaccacatggacgatgatgacgacgacgatgacgacggagaccatgcagagagc
gaggattctgtgaactcggatgaatctgacgaatctcaccattccgatgaatctgatgag
tccttcactgccagcacacaagcagacgttttgactccaatcgcccccacagtcgatgtc
cctgacggccgaggtgatagcttggcttacggactgaggtcaaagtccaggagtttccct
gtttctgatgaacagtatcccgatgccacagatgaggacctcacctcccgcatgaagagc
caggagtccgatgaggctatcaaggtcatcccagttgcccagcgtctgagcgtgccctct
gatcaggacagcaacgggaagaccagccatgagtcaagtcagctggatgaaccaagcgtg
gaaacacacagcctggagcagtccaaggagtataagcagagggccagccacgagagcact
gagcagtcggatgcgatcgatagtgccgagaagccggatgcaatcgatagtgcggagcgg
tcggatgctatcgacagtcaggcgagttccaaagccagcctggaacatcagagccacgag
tttcacagccatgaggacaagctagtcctagaccctaagagtaaggaagatgataggtat
ctgaaattccgcatttctcatgaattagagagttcatcttctgaggtcaattaa

DBGET integrated database retrieval system