KEGG   Rattus norvegicus (rat): 116718
Entry
116718            CDS       T01003                                 

Gene name
Pex12
Definition
(RefSeq) peroxisomal biogenesis factor 12
  KO
K13345  peroxin-12
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    116718 (Pex12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    116718 (Pex12)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Peripheral membrane proteins
    116718 (Pex12)
SSDB
Motif
Pfam: Pex2_Pex12 zf-C3HC4_3 zf-C3HC4_2 zf-RING_2 zf-C3HC4 DZR_2
Other DBs
NCBI-GeneID: 116718
NCBI-ProteinID: NP_446373
RGD: 620757
Ensembl: ENSRNOG00000009718
Vega: OTTRNOG00000000477
UniProt: O88177
Position
10q26
AA seq 359 aa
MAEHGAHITTASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPAHYGFFWRWFD
EIFTLLDFLLQQHYLSRTSASFSEHFYGLKRIVAGSSPQLQRPASAGLPKEHLWKSAMFL
VLLPYLKVKLEKLASTLREEDEYSIHPPSSHWKRFYRVFLAAYPFVTMTWEGWFLTQQLR
YILGKAEHHSPLLKLAGVRLGRLTAQDIQAMEHRLVEASAMQEPVRSIGKKIKSALKKAV
GGVALSLSTGLSVGVFFLQFLDWWYSSENQETIKSLTALPTPPPPVHLDYNSDSPLLPKM
KTVCPLCRKARVNDTVLATSGYVFCYRCVFNYVRSHQACPITGYPTEVQHLIKLYSPEN
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggctgagcatggggctcatatcacaactgcttcggtggcggacgaccagccatccatc
tttgaggtggtagcacaggacagtttaatgacagcagtgagacccgctcttcagcatgtg
gtcaaggttcttgcagaatcaaatcctgcgcactatggcttcttttggaggtggtttgat
gaaatcttcactctgctagactttctgctccagcagcattatctttctagaactagtgcc
tcattttctgaacacttttatgggttaaagcggattgtagcggggagctcgccgcagctt
cagagaccagccagtgctggcctccccaaggaacacctctggaaatccgctatgttcctt
gttcttcttccctatctgaaagtgaagctggagaagctggcttctaccttgagagaagaa
gacgaatactctattcaccccccttcttctcactggaaacgattctacagagtcttcctg
gctgcctacccgtttgttaccatgacctgggaaggctggttccttacacaacaacttcgg
tacatattgggaaaagctgagcatcactctcccctgctgaaactggctggagttcggcta
ggtcgactgacagctcaggacatacaagctatggaacacagactggttgaagccagtgca
atgcaggagcccgtcagaagcattggtaagaagataaagtcagcactgaagaaagctgtg
ggaggtgttgccttatccctctctactggcctctctgtgggtgtattcttcctgcagttt
cttgactggtggtactcttctgagaaccaagagaccatcaagtcactgactgccctgccc
actccaccaccacctgtgcacctcgactacaactctgattctcccctcttacccaaaatg
aaaacagtgtgcccactgtgtcgtaaagctcgggtcaatgatacggttcttgccacctct
ggctatgtattctgttaccgctgtgtgtttaattatgtgagaagtcaccaagcctgtccc
attacagggtatccaacggaagtccagcatctaattaaactctactctccagagaactga

DBGET integrated database retrieval system