KEGG   Rattus norvegicus (rat): 116720
Entry
116720            CDS       T01003                                 

Gene name
Pik3c2g
Definition
(RefSeq) phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 gamma
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04070  Phosphatidylinositol signaling system
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    116720 (Pik3c2g)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    116720 (Pik3c2g)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    116720 (Pik3c2g)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     116720 (Pik3c2g)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PX C2 PI3K_rbd DUF4135
Other DBs
NCBI-GeneID: 116720
NCBI-ProteinID: NP_446375
RGD: 620231
Ensembl: ENSRNOG00000034228
UniProt: O70173
Position
4q44
AA seq 1505 aa
MAYNWQTEPNRAEPQEGGHDHQQCHHADQHLSSRQVRLGFDQLVEELSNKTPLPEDEKEG
TCFVPDTPNLDSKWQSIYGPHPRHFNEFTSQSPHFSQLPFGKASAIGFNPAVLPAHQFIH
EGASWRNPTRKYHGGEDPRFSALTPSSTGLDKCHQQGQSGTEHCNYYVEPENNVPHHYSP
YSMDSIPDSEEKGSGDADLVEPSLVFSKDSFLPRASENMSVESTEPIGCPLEIVEAPQGS
NKSLASFCNNVTKIRGLYHASDTNSNSGKIWAITTAYPSRLFADTQFRVKISTDNSAQLL
LLKPPANYLVKDLIAEILLLCANEQLSPKEYLLSICGSEEFLQTDHCLGSHKIFQKSKSV
IQLHLQRSRDTPGKLSRKRDDDRSRVHLNQLLEFTHIWKISRQCLSTVMKSYNLHVEHLL
KTQEDVEEKPLSSMFSCGRHPPQPHGNDIIEDVRNICSVLGCIETKQVSDAVKELTLILQ
RPSQNFHQNSETSKKGFIENVTSELSRSLHQLVDVYCSSFCTDFRPARAPGGVSRDHAGL
HSHLSFTVCSLHNVPETWAHSYKAFSFSCWLTYAGKKLCQVKSCRSLPVTKSFSFSVNWN
EIINFPLEIKSLPRESMLVIKLFGIDSATHSANLLAWTCLPLFPKEKSPLGSRLLSMTLQ
SEPPIEMMAPGVWDGSQPTPLTLQIDFPAATWEYVKPETEENRTDHQEPPRECLKHIARL
SQKQPPLLLSVEKRRYLWFYRFYCNNENSSLPLVLGSAPGWDEGTVSEMHAVLRRWTFSH
PLEALGLLTSRFPDQDIREVAVQQLDNFLTDELLDCLPQLVQAVKFEWSLESPLVELLLH
RSLQSIRVAHRLFWLLRDAQGEDYFKSWYQELLAALQFCAGEALIEELSKEQKLVKLLGD
IGEKVKSAGDAQRKDVLKKEIGSLEEFFKDIKTCHLPLNPALCVKGIDRDACSYFTSNAL
PLKITFINANPMGKNISVIFKAGDDLRQDMLVLQIIQVMDNVWLQEGLDMQMIIYGCLAT
GKAQGFIEMVPDAVTLAKIHLHSGLIGPLKENTIKKWFSQHNHLKEDYEKALRNFFYSCA
GWCVVTFILGVCDRHNDNIMLTKSGHMFHIDFGKFLGHAQTFGGIKRDRAPFIFTSEMEY
FITEGGKNTQHFQDFVELCCRAYNIVRKHSQLLLSLLEMMLHAGLPELRGIEDLKYVHDN
LRPQDTDLEATSHFTTKIKQSLECFPVKLNNLIHTLAQMPAFSLARPAPQTPPQECCVLN
KTRTIQRVTILGFSKTHSNLYLIEVTRSDNRKNLAKKSFEQFYRLHSQIQKQFPLLTLPE
FPHWWHLPFTDSHHERIRDLSHYVEQVLHGSYEVANSDCVLSFFLSEHIQQTLEDSPFVD
PGDHSPDKSPQVQLLMTYEDTKLTILVKHLKNIHLPDGSAPSAHVEIYLLPHPSEVRRKK
TKCVPKCTDPTYNEIVVYDDVSGLQGHVLMLIVKSKTVFVGAVNIQLCSVPLNEEKWYPL
GNSII
NT seq 4518 nt   +upstreamnt  +downstreamnt
atggcatacaattggcaaacagagccaaaccgtgctgaaccacaggaaggtggacatgat
caccagcagtgtcaccatgcagaccagcacctttcttccaggcaagtcaggttgggtttt
gatcagcttgtggaagagctcagtaacaaaactccactgcctgaggatgaaaaagaaggc
acgtgttttgtaccagatacaccaaacttggattcaaaatggcaatccatatatggaccc
cacccaaggcacttcaatgaattcacttctcagagtccccacttctcccagcttcctttt
ggaaaagcatcagccattggttttaatcctgctgtattacctgcacatcagttcattcat
gagggagcctcctggagaaatcccacaagaaaatatcatggtggtgaggatcccaggttc
agtgctctaactccgtcatccactggcttggataaatgtcatcaacaaggacaatcaggg
accgaacattgtaactattatgtggaacctgaaaacaatgttccccatcattattcaccc
tactcaatggactccatacccgatagtgaggaaaaaggaagtggagatgcggatcttgta
gaaccttctctggtgttctctaaagactcctttctacccagggcatcggagaacatgtca
gtggaaagcacagagcccattggttgcccccttgaaatagttgaagcaccccaagggagt
aacaagagcctcgcctccttttgcaacaatgtaacaaaaataagaggactatatcatgca
agtgacactaattccaattccggaaagatctgggccatcaccacagcctatccatctcgg
ctcttcgctgacacccagttcagagttaaaatttccactgataactcggcacaacttctt
cttcttaagccacccgctaattatcttgtcaaagacctaattgccgaaattctactttta
tgtgcaaatgagcagctttcccccaaagagtatcttctaagtatatgcggttctgaggaa
tttttacagacggatcactgtctagggagccacaaaatatttcagaaaagtaaatctgtc
attcaactccatctccagagaagcagggacactccaggaaaattatcccggaagagggat
gatgaccgcagtcgggtccatctgaaccaacttctagaatttacacatatttggaaaata
tccagacaatgcctctccacagtaatgaaaagctacaacctccatgtcgagcacctgttg
aaaacccaggaagatgtggaggagaaacctctgtcatccatgttttcctgtggccgacac
cctcctcagccacatgggaatgacattattgaagatgttagaaacatatgcagtgttctg
gggtgtattgaaaccaaacaagtttcagatgcagtaaaagaactaactctaattctgcag
agaccatcacagaattttcatcagaattcagagacttcaaaaaaaggcttcatagagaac
gtgacatcggaactgtcgaggtccctccatcagctggttgacgtgtactgcagtagcttt
tgtacagatttccggcctgcgcgcgcacctggaggcgtctcccgcgaccacgctgggctc
cactcccacctgagcttcacggtgtgttccctgcacaatgttccagaaacttgggcacac
agctacaaagcattttcattttcctgctggctcacatatgctgggaagaagctgtgccaa
gtgaaaagctgcagatccctgccagtcacaaagtcattctctttttcggtgaactggaat
gaaataatcaattttcctcttgagataaagtcacttccaagagaatccatgctcgttata
aagctgtttgggattgacagtgccacccacagcgcaaatctgctggcctggacctgcctt
ccactatttccaaaagaaaagtctccgctggggtctaggcttctcagcatgacactacag
agtgagcctcctatagaaatgatggctccaggagtatgggatgggagccagcctacccca
ctgaccctgcagatagattttccagctgccacgtgggagtacgtgaaacctgagactgaa
gagaacagaactgaccaccaagagcctccaagagagtgtttaaaacacatcgccagactc
tcccaaaagcagcctcccttgctactttctgtggaaaagaggagatatttgtggttttat
cgtttctactgcaacaatgagaactcctctctccctctggtcttgggcagcgcccctggt
tgggatgaagggacagtttcggaaatgcatgccgtcttgagaaggtggacattttcccat
ccgttggaagctcttggccttttgacttccaggtttccagaccaagacattcgtgaagtt
gccgttcaacagttagacaacttcttgaccgatgagctgctggactgcctcccacagcta
gttcaggctgtcaagtttgagtggagtctcgaaagtcccttggtggaactcctgcttcat
cgatccttgcaaagcatccgagtggctcaccgcctgttctggctgctgcgggatgcacaa
ggtgaagactactttaaaagctggtaccaggagcttttggccgctctccagttctgtgca
ggagaagccctgatcgaagagctttccaaagagcagaaacttgtcaaactcctgggtgat
attggagaaaaagtgaagtcggctggcgatgctcagagaaaggatgtgctaaagaaggag
attggcagtctagaagaattctttaaagatataaagacttgccatcttcctctgaacccg
gccctgtgcgtaaaaggaattgatcgggatgcatgttcatatttcacatctaatgccttg
ccattgaagatcactttcatcaatgctaatccaatgggcaaaaatatcagtgttattttt
aaggccggcgacgatcttcggcaggatatgcttgttctgcagattattcaagtgatggac
aacgtttggcttcaggagggcctcgatatgcaaatgatcatttatggatgtctagccaca
ggaaaggctcaaggattcatagagatggtgcctgatgctgtaacgcttgccaagatccat
ctgcactctgggctgataggacccctgaaagaaaacaccatcaagaagtggttcagtcag
cacaaccacttaaaggaagattatgaaaaggccttgaggaactttttttactcttgtgct
ggctggtgtgtggtgacattcatcttgggagtctgtgaccgacataatgacaatatcatg
ctgacaaagtcaggccacatgtttcatattgactttggaaaattcttgggtcacgcacaa
acatttggcggtataaaaagggaccgagcgcctttcatttttacttcagagatggagtac
tttattacggagggtgggaaaaacacacagcattttcaagacttcgtggaactctgctgc
agagcctacaacattgtgaggaagcacagccaactgctcctgagccttctagaaatgatg
ctgcatgccgggcttcctgagctgagggggattgaagacctgaaatacgtacacgacaat
ctccggccacaagacacagacctggaagccacaagtcattttaccacgaagataaagcag
agtctggagtgcttcccagttaaactgaataacctgatccacacgcttgcacagatgcca
gccttcagccttgccagacctgcccctcagactcctccccaggagtgctgcgtcctgaat
aaaaccaggacaattcagagagtcacaattttagggttcagcaagacacacagcaacctg
tacctgatcgaggtgacacgcagcgacaacaggaaaaacctggccaaaaagtccttcgag
cagttttacagacttcacagccagattcagaagcagttccccttgttgactctcccagag
tttcctcactggtggcatctacctttcacagactcgcaccatgagagaatccgagatctg
agtcactacgtggaacaggtgctgcacggatcttacgaagtcgcaaacagtgattgtgta
ctcagtttttttctctctgaacatatacaacagacccttgaagactctccatttgtggac
ccaggtgaccattctccagacaagagcccccaggtgcagttgctgatgacctatgaggac
acaaagctcaccatcctagtgaaacacttgaaaaacatccatctcccagatggctcagcg
cccagcgcacatgttgaaatttatcttctgccacatcccagtgaagttcgcaggaagaaa
acaaagtgcgttccaaaatgcactgacccaacttacaatgaaattgtggtatatgatgac
gtctcaggacttcagggacatgttttaatgctcattgtgaagagcaaaactgtatttgtg
ggagcggttaacattcagctctgcagtgttcccctcaatgaagaaaagtggtacccatta
gggaacagtatcatctga

DBGET integrated database retrieval system