KEGG   Rattus norvegicus (rat): 116721Help
Entry
116721            CDS       T01003                                 

Gene name
Abcc5, Abcc5a, Mrp5
Definition
(RefSeq) ATP binding cassette subfamily C member 5
  KO
K05668  ATP-binding cassette, subfamily C (CFTR/MRP), member 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01523  Antifolate resistance
rno02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    116721 (Abcc5)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    116721 (Abcc5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    116721 (Abcc5)
Transporters [BR:rno02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    116721 (Abcc5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_tran ABC_membrane SMC_N AAA_29 MMR_HSR1 AAA_23 Dynamin_N RsgA_GTPase AAA_7 AAA_24 TsaE cobW LVIVD AAA_13
Motif
Other DBs
NCBI-GeneID: 116721
NCBI-ProteinID: NP_446376
RGD: 70913
Ensembl: ENSRNOG00000029178
UniProt: Q9QYM0
Position
11q23
AA seq 1436 aa AA seqDB search
MKDIDMGKEYIIPSPGYRSVRDRSTIPGQHGDREEPRFRRTRSLECQDALETAARVEGLS
LDISVHSHLQILDEEHTKGKYHHGLSALKPFRTTTKHQHPVDNAGLFSYMTFSWLSPLAQ
VVHKKGELLMEDVWPLSKYESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLI
LSIVCLMITQLAGFSGPAFVVKHLLEYTQATESNLQYSLLLVLGLLLTEVVRSWSLALTW
ALNYRTGVRLRGAVLTMAFKKILKLKNIKEKSLGELINICSNDGQRMFEAAAVGSLLAGG
PVVAILGMIYNVIILGPTGFLGSAVFILFYPAMMFVSRLTAYFRRKCVAATDDRVQKMNE
VLTYIKFIKMYAWVKAFSQCVQKIREEERRILEKAGYFQSITVGVAPIVVVIASVVTFSV
HMTLGFDLTAAQAFTVVTVFNSMTFALKVTPFSVKSLSEASVAVDRFKSLFLMEEVHMIK
NKPASPHIKIEMKNATLAWDSSHSSTQSSPKLTPKVKKDKRAPKGKKEKSRQLQHTEHQA
VLAEQKGHLLLDSDERPSPEEEEGKQIHAGSMRLQRTLYNIDLEIEEGKLVGICGSVGSG
KTSLISAILGQMTLLEGSIAVSGTFAYVAQQAWILNATLRDNILFGKEFDEERYNSVLNS
CCLRPDLAILPNSDLTEIGERGANLSGGQRQRISLARALYSDRSIYILDDPLSALDAHVG
NHIFNSAIRKRLKSKTVLFVTHQLQYLVDCDEVIFMKEGCITERGTHEELMNLNGDYATI
FNNLLLGETPPVEINSKKEASGSQKSQDKGPKPGSVKKEKAVKSEEGQLVQVEEKGQGSV
PWSVYWVYIQAAGGPLAFLVIMVLFMLNVGSTAFSTWWLSYWIKQGSGNSTVFEGNRSSV
SDSMRDNPFLQYYASIYALSMAVMLILKAIRGVVFVKGTLRASSRLHDELFRRILRSPMK
FFDTTPTGRILNRFSKDMDEVDVRLPFQAEMFIQNVILVFFCVGMIAGVFPWFLVAVGPL
LILFSVLHIVSRVLIRELKRLDNITQSPFLSHITSSIQGLATIHAYNKRQEFLHRYQELL
DDNQAPFFLFTCAMRWLAVRLDLISIALITTTGLMIVLMHGQIPSAYAGLAISYAVQLTG
LFQFTVRLASETEARFTSVERINHYIKTLSLEAPARIKNKAPPHDWPQEGEITFENAEMR
YRENLPLVLKKVSFTIKPKEKIGIVGRTGSGKSSLGMALFRLVELSGGCIKIDGVRISDI
GLADLRSKLTIIPQEPVLFSGTVRSNLDPFNQYTEEQIWDALERTHMKECIAQLPLKLES
EVMENGDNFSVGERQLLCIARALLRHCKILILDEATAAMDTETDLLIQETIREAFADCTM
LTIAHRLHTVLGSDRIMVLAQGQVVEFDTPSVLLSNDSSRFYAMCAAAENKVAVKG
NT seq 4311 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatattgacatgggaaaagaatacatcatccccagtcccggatacagaagcgtc
agggacagaagcactatcccgggacaacacggcgatcgtgaagaacccaggttccggaga
acaagatcattggaatgccaagatgccctagaaacagcagcccgagttgagggtctttcc
ctggacatctctgtgcattctcatctccaaattctggacgaggaacatacgaaggggaaa
taccaccatggtttaagcgccctgaagcccttccggaccaccaccaagcaccagcaccca
gtggacaatgctggccttttctcctacatgaccttttcatggctctctcctctggcccaa
gtggttcacaagaagggggagctgttaatggaggatgtgtggcctttgtccaagtatgag
tcttctgatgtgaactgcagaagactagagagactgtggcaagaagagctgaatgaagtc
gggccagacgccgcctccctgcgaagggttgtgtggatcttttgccgcaccaggctcatc
ctgtccatcgtgtgcctgatgatcacgcagttggctggcttcagtggaccagccttcgtg
gtgaagcacctcttggagtacacccaggcaacagagtctaacctgcagtacagcttgctg
ttggtactaggcctcctcctgacagaggttgtacgctcctggtcactcgcactgacttgg
gcattgaattatcgcactggtgtccggctgcggggggctgtcctgaccatggcattcaag
aagatcctgaagctaaagaacattaaggaaaagtccctgggggagcttatcaatatctgc
tccaacgatgggcagaggatgtttgaagcagccgctgtgggcagcttgctggccggagga
cccgttgtcgccatcttgggcatgatttataatgtaatcattctaggaccaacgggcttc
ctgggatcggctgtctttatcctcttttatccggcaatgatgttcgtgtcacggctaacc
gcgtatttcaggagaaagtgtgtagccgccacagacgaccgtgtccagaagatgaatgaa
gttcttacctacattaaatttattaaaatgtatgcctgggtcaaagcgttttctcagtgt
gttcaaaaaatccgagaggaggagcgtcggatcctggagaaggccgggtactttcagagc
atcaccgttggagtggctcccattgtcgtagtgatcgccagcgtggtgacgttctccgtc
cacatgaccctgggcttcgacctgacagcggcgcaggccttcacagtggtgactgtcttc
aattccatgacttttgctttaaaagtaacaccattctcagtgaagtccctctctgaagca
tccgttgctgttgacagatttaagagtttgtttctaatggaagaggttcacatgataaag
aacaaaccggccagtcctcacatcaagatagagatgaaaaatgccaccttggcatgggac
tcctcccactccagtacacagagctcgcccaagctgacccccaaagtgaaaaaagacaag
agggctcccaagggcaagaaagagaagtcgaggcagctgcaacatactgagcaccaggcg
gtgctggcagagcagaaaggacacctcctcctggacagtgatgagcggcccagtccggaa
gaggaagaaggcaagcagatccacgcagggagcatgcgtctgcagaggacactctacaac
attgacttagagattgaagagggcaaactggttggaatctgtggcagtgtgggaagtgga
aaaacctctctgatttccgccattttaggccagatgacgcttttggagggcagcattgcc
gtcagtgggacctttgcttacgtggcccaacaggcctggattctcaacgccacgctgaga
gacaacattctctttgggaaggaatttgatgaagagagatacaactcagtgctgaacagt
tgctgcctgcggcctgacttggccattctccccaacagcgacctgactgagattggagag
cgaggagccaacctgagtggtgggcagcgccagcgaatcagccttgctcgagccctgtac
agtgacagaagcatctatatcttggatgatcccctcagtgccttagatgcccatgtgggc
aaccacatcttcaacagtgctatccggaagcgtctcaagtctaagacggtcctgtttgtc
acacaccagttacagtacctggtcgattgtgatgaggtgatcttcatgaaagaaggctgt
atcacagagagaggtacccacgaggagctgatgaacttaaatggagactacgctaccatt
tttaataacctgttgctgggagagacacccccggtcgagattaattcaaaaaaggaagct
agtggttcacaaaaatcacaagacaagggccctaagccagggtcagtgaagaaggagaag
gcagtgaagtcggaggaagggcagctcgtgcaggtggaggagaaagggcagggctccgtg
ccttggtcagtttactgggtctacatccaggctgcagggggtcccttggctttcctggtc
atcatggtcctcttcatgctcaatgtgggcagcactgccttcagcacctggtggctaagc
tactggatcaagcaaggaagcgggaacagcacggtgtttgaagggaacagaagctctgtg
agtgacagcatgagggacaaccccttcctgcagtactatgccagcatctacgctctctcc
atggcagtcatgctgatcctgaaggccatccgaggagttgtctttgtcaagggtacactg
agagcctcctcccggctccatgatgagctcttccggaggatcctgagaagccccatgaag
ttttttgatactaccccaacaggaaggattctcaacaggttttccaaagacatggatgaa
gtggacgtgcgtctgccattccaggctgagatgtttatccagaatgtgatcctggtgttc
ttctgtgttggaatgatcgcaggggtcttcccatggttccttgtggcagtggggcctctc
ctcatcctcttctcagttctacacattgtctccagggtcctgattcgggagctgaagcgc
ttggacaatatcacgcaatctcctttcctctcccatatcacgtccagcattcagggcctc
gccaccatccatgcctataacaaaaggcaggagtttctacacaggtatcaggagcttctg
gatgacaaccaagcccccttcttcttgttcacctgtgcaatgaggtggctggcagtgcgg
ctggacctcatcagcatcgccctgatcaccaccacggggctcatgattgttctcatgcac
gggcagatcccttcagcgtacgcgggcctcgccatctcctacgctgtgcagttaaccgga
ctcttccagtttaccgttagactggcgtcggagacagaagcacggttcacctcagtggag
aggatcaaccactacataaagactctctctttggaagcacctgccagaatcaagaacaag
gctcctccccatgactggccccaggagggagaaataacctttgagaatgcggaaatgaga
taccgggaaaatctccctctggtccttaagaaagtgtccttcaccatcaagcccaaggaa
aagataggcattgtgggacgaacagggtcagggaagtcctctctagggatggccctcttc
cgcctggtggagttatctggaggctgcatcaagatcgatggagtaagaatcagtgacatt
ggcctggccgacctccgaagcaaactgaccatcatccctcaggagccagtgctgttcagc
ggcacagtcagatcaaacctggaccctttcaaccagtacacagaagagcagatctgggat
gccctagagagaacacacatgaaggaatgtattgcccagctacctctgaaactggaatct
gaagtaatggagaacggggacaacttctctgttggggaacggcagttgttatgcatagca
agggccctgctacgtcactgtaagattctgattttagatgaagctacagccgctatggac
acagagacagacttactgatccaagagaccatccgggaagcatttgctgactgcaccatg
ctgaccattgcccatcgcctgcacacagttctgggctctgataggatcatggtgctggcc
cagggacaggtggtggagtttgacaccccgtcggtccttctgtccaacgacagctcaaga
ttctatgccatgtgtgctgctgcagagaacaaggtggctgtcaagggctga

DBGET integrated database retrieval system