KEGG   Rattus norvegicus (rat): 116725Help
Entry
116725            CDS       T01003                                 

Gene name
Ube2n
Definition
(RefSeq) ubiquitin-conjugating enzyme E2N
  KO
K10580  ubiquitin-conjugating enzyme E2 N [EC:2.3.2.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    116725 (Ube2n)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    116725 (Ube2n)
   03400 DNA repair and recombination proteins [BR:rno03400]
    116725 (Ube2n)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     116725 (Ube2n)
Ubiquitin system [BR:rno04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   116725 (Ube2n)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    116725 (Ube2n)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con Prok-E2_B UEV RWD
Motif
Other DBs
NCBI-GeneID: 116725
NCBI-ProteinID: NP_446380
RGD: 621096
Ensembl: ENSRNOG00000058053
UniProt: Q9EQX9
Position
7q13
AA seq 152 aa AA seqDB search
MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPE
EYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP
LANDVAEQWKSNEAQAIETARAWTRLYAMNNI
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggccgggctgccccgcaggatcatcaaggaaacccagcgtttgctggcagaaccagtt
cctggcattaaagcagaaccagatgagagcaacgcccgttattttcatgtggtcattgct
ggtccccaggattccccctttgagggagggacttttaaacttgaactattccttccagaa
gaatacccaatggcagcacctaaagtacgtttcatgaccaaaatttatcatcctaatgta
gacaagttgggaagaatatgtttagatattttgaaagataagtggtccccagcactgcag
atccgaacagttctgctatcaatccaggctttgttaagtgctcctaatccagatgatcca
ttagcaaatgatgtagctgagcagtggaagagcaacgaagcccaagccatagaaacagca
agagcatggactaggctatatgccatgaacaatatttaa

DBGET integrated database retrieval system