KEGG   Rattus norvegicus (rat): 116726
Entry
116726            CDS       T01003                                 
Symbol
Slc7a9
Name
(RefSeq) B(0,+)-type amino acid transporter 1
  KO
K13868  solute carrier family 7 (L-type amino acid transporter), member 9/15
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    116726 (Slc7a9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    116726 (Slc7a9)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   116726 (Slc7a9)
SSDB
Motif
Pfam: AA_permease_2 AA_permease
Other DBs
NCBI-GeneID: 116726
NCBI-ProteinID: NP_446381
RGD: 619905
Ensembl: ENSRNOG00000012344
UniProt: P82252
Position
1:88109517..88132653
AA seq 487 aa
MEETSPRRRREDEKSVHSTEPKTTSLQKEVGLLSGICIIVGTIIGSGIFISPKSVLANTE
SVGPCLIIWAACGVLATLGALCFAELGTMITKSGGEYPYLMEAFGPIPAYLFSWTSLIVM
KPSSFAIICLSFSEYVCAAFYLGCRPPAVVVKLLAAAAILLITTVNALSVRLGSYVQNVF
TAAKLVIVAIIIISGLVLLAQGNVKNFQNSFEGSQTSVGSISLAFYNGLWAYDGWNQLNY
ITEELRNPYRNLPMAIVIGIPLVTVCYILMNIAYFTVMTPTELLQSQAVAVTFGDRVLYP
ASWVVPLFVAFSTIGAANGTCFTAGRLIYVAGREGHMLKVLSYISVKRLTPAPALVFYGI
IAIIYIIPGDINSLVNYFSFAAWLFYGMTILGLVVMRFTRKDLERPIKVPIFIPIIVILV
SVFLILAPIISSPAWEYLYCVLFILSGLIFYFLFVHYKFRWAQKISRPITKHLQMLMEVV
PPEKDPE
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggaggagacaagcccgaggagacggagagaggatgagaagtccgtccacagtacagag
cccaagaccacaagtctccagaaagaggtgggtcttctcagtggtatctgtatcattgtg
ggcaccatcatcggctccgggatcttcatctcccccaagtctgtgctggccaacacagaa
tccgtggggccctgtctcatcatatgggcagcctgtggagtcctggctacactgggcgcc
ctgtgctttgcagagcttggcacaatgatcaccaagtcagggggtgagtacccctatctg
atggaggccttcggccccatccctgcctacctcttctcctggaccagcctgattgtcatg
aagccctcatccttcgccatcatctgcctcagcttttcagagtatgtgtgtgcggccttt
tacttaggctgcaggcctcctgctgtggtagtgaaactcctggctgctgctgccatcttg
cttatcactacagtgaatgcgctgagcgtgcggcttggcagctatgtgcagaatgtcttc
acggcagccaagctggtgatcgtcgccatcatcatcatcagcggactggtcctcctggcg
caaggaaatgttaagaactttcagaattcttttgagggttcacagacctctgtgggctcc
atcagcctggcattttacaacggactctgggcctacgatgggtggaaccaacttaactac
atcactgaagagcttagaaacccttacagaaacctgcccatggccattgtcattgggatc
cctctggtgacagtatgctacatcctcatgaatattgcttacttcacagtgatgacccca
acggagctcttgcagtcccaggctgtggctgtgaccttcggagaccgtgttctctatccg
gcatcttgggtagtcccactttttgtggcattttcaaccattggtgctgcgaatgggacc
tgctttacggcgggcaggctcatctatgtggcgggccgggaaggccacatgcttaaagtg
ctatcctacatcagtgtcaagcgcctcactccggcccctgccctcgtattctatggcata
atagccatcatttacatcatccccggggacatcaactccttagtcaattatttcagtttt
gctgcatggctcttttatggcatgacaatcctaggactcgttgtgatgagattcacaagg
aaagacctagagaggcccatcaaggtgcccatcttcatccctatcattgtgattctcgta
tctgttttcttgatcctggcccccatcatcagttcgccagcctgggaatatctctactgc
gtgttgttcatactgagtggacttatattttacttcctttttgtccactacaagttcaga
tgggcccagaaaatctccaggccgatcaccaagcacctgcagatgctgatggaagttgtc
ccaccagagaaggacccagagtaa

DBGET integrated database retrieval system