KEGG   Rattus norvegicus (rat): 116740
Entry
116740            CDS       T01003                                 

Gene name
B3gnt5
Definition
(RefSeq) lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase
  KO
K03766  beta-1,3-N-acetylglucosaminyltransferase 5 [EC:2.4.1.206]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00601  Glycosphingolipid biosynthesis - lacto and neolacto series
rno01100  Metabolic pathways
Module
rno_M00070  Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
rno_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    116740 (B3gnt5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    116740 (B3gnt5)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.206  lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase
     116740 (B3gnt5)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   116740 (B3gnt5)
SSDB
Motif
Pfam: Galactosyl_T Fringe
Other DBs
NCBI-GeneID: 116740
NCBI-ProteinID: NP_446384
RGD: 70955
Ensembl: ENSRNOG00000046258
UniProt: Q99NB2
Position
11
AA seq 377 aa
MRVFVSSRRVKRWQFFHLFAICFILSFMVFWGPINNYIMSHMKSYSYRYLINSYDFVNDS
LSLKHSSVQPHHPYLINHREKCQAQDVLLLLFIKTAPENYERRSAIRKTWGNENYVQSQL
NANIKILFALGTPHPLKGKELQKRLIWEDQVYHDIIQQDFTDSFHNLTFKFLLQFGWANT
FCPHARFLMTADDDIFIHMPNLIEYLQGLEQVGVRDFWIGHVHRGGPPVRDKSSKYYVPY
EMYKWPAYPDYTAGAAYVVSNDVAAKIYEASQTLNSSMYIDDVFMGLCANKVGVVPQDHV
FFSGEGKIPYHPCIYEKMITSHGHSQDLQDLWVEATDPKVKDISKGFFGQIYCRLIKIVL
LCRLTYRNSYPCRAAFA
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgagagtattcgtcagcagcagaagagtcaaaagatggcagttttttcacttatttgcc
atttgttttatattaagctttatggttttttggggcccgatcaataattacatcatgagc
cacatgaagtcctactcctacagataccttataaatagctatgactttgtgaacgattcc
ctgtctctcaagcacagctctgtgcagcctcaccacccatacttgatcaaccacagagag
aagtgtcaggcccaagatgtcctcctcttactctttataaagactgcccctgaaaactac
gagcgacgttctgccatcagaaagacgtggggcaacgagaattacgtccagtctcagctc
aacgccaacatcaaaattctgttcgcgttaggaactcctcatccactgaagggaaaagag
ctgcaaaaaagactgatttgggaagatcaagtgtaccacgacataattcagcaagatttc
actgattctttccacaatcttacttttaaatttcttcttcagttcggctgggcaaacacc
ttttgcccacatgccagattcctgatgactgctgatgatgacatatttatccacatgcca
aatctcattgaataccttcaagggctggagcaggttggagttcgagacttttggattggt
cacgttcaccgagggggccctcctgttagagacaaaagtagcaagtactatgttccctat
gaaatgtacaagtggccagcctaccctgactataccgccggtgctgcctatgtcgtctcc
aacgatgtagctgccaaaatctatgaggcatcacagacgctgaattccagcatgtacata
gacgatgtgttcatgggcctctgcgccaataaagtgggggtcgtgccacaggaccatgta
tttttctctggggaagggaagattccttaccatccctgcatctatgaaaagatgataacg
tctcatggacactcacaagacctacaggacctctgggtggaggccacagatcctaaagtg
aaggacatttcgaaagggttttttggtcagatctactgcaggttaattaagatagttctt
ctctgcagactgacttacaggaactcatacccttgtagggctgcatttgcttaa

DBGET integrated database retrieval system