KEGG   Rattus norvegicus (rat): 116742Help
Entry
116742            CDS       T01003                                 

Gene name
Pcdha13, Cnr5
Definition
(RefSeq) protocadherin alpha 13
  KO
K16493  protocadherin alpha
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    116742 (Pcdha13)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    116742 (Pcdha13)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    116742 (Pcdha13)
Cell adhesion molecules [BR:rno04515]
 Cadherins
  Protocadherins
   116742 (Pcdha13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_tail Cadherin_2 Cadherin_C_2
Motif
Other DBs
NCBI-GeneID: 116742
NCBI-ProteinID: NP_446386
RGD: 620751
UniProt: I6LBW4
Position
18p11
AA seq 950 aa AA seqDB search
MLLFSQSGPGSRCLLLSFLLFSAWEAGSGQLHYSIPEEAKHGTFVGRIAQDLGLELTELV
PRLFRVASKDRGDLLEVNLQNGILFVNSRIDREELCGRSAECSIHLEVIVDRPLQVFHVE
VEVKDINDNPPVFPETNKNIVIAESRPPETRFPLDGASDADIGINSALTYRLDPSDYFAL
ATQNNRERPSSLSLVLKKSLDREEIQEHSLLLTASDGGKPELTGTVQLLITILDVNDNAP
EFDRFVYRVRVLEDVFNGTLVINLNATDPDEGTNGDIIYSFRRPVSPAVVHAFNIDPNSG
EVRTKGLLDFEEIKLYEIPVEAVDKGNIPMTGHCTLLVEVLDVNDNAPEVTITSLSLPVK
EDAQPSTVIALVSVSDRDSGDNGQVTCSLTPHLPFKLVSTFKNYYSLVLDSALDRETTAD
YKVVVTARDGGSPSLWATASVSVEVADVNDNVPVFAQPEYTVFVKENNPPGAHIFTVSAV
DTDAQENALVSYSLVERRVGERLLSSYVSVHAESGKVFALQPLDHEELELLQFQVSARDA
GVPALGSNVTLQVFVLDENDNVPTLLPHRAVGAGGAVSELVPRSVGSGHVVAKVRAVDAD
SGYNAWLSYELQLAAGAMSSPFRVGLYTGEISTTRALDEADAPRQRLLVLVKDHGEPALT
ATATVLVSLVENGQAPKISSLASESIASSEASLVTVNVYLIIAICAVSSLLVLTLLLYTA
LRCSARPINGACVPGKPMLVCSSAVGSWSYSQQRRQRVCSGEGPPKTDLMAFSPSLPPVL
GSAEDTCQRERQVEHLKEPRQPNPDWRYSASLRAGMHSSVHLEEAGILRAGPGGPDQQWP
TVSSATPEPEAGEVSPPVGAGVNSNSWTFKYGPGNPKQPGPGELPDKFIIPGSPAIISIR
QESANNQIDKSDFITFGKKEETKKKKKKKKGNKTQEKKEKGNSTTDNSDQ
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atgctattattctcgcaaagcggcccaggatcccggtgcctcctgctctctttcctgctc
ttctcagcctgggaggcagggagcggccagctccactactccatccctgaggaggccaaa
cacggcaccttcgtgggccgcatcgcacaggacctggggctggagctgacggagctggtg
ccccgtctattcagggtggcgtccaaggaccgcggagaccttctggaggtaaatctgcag
aatggcattttgtttgtgaattctcggatcgaccgggaggagctgtgcgggaggagcgcg
gagtgcagcatccacctggaggtgattgtggacaggccgctgcaggttttccacgtggag
gtggaggtgaaggacattaacgacaacccgcccgtgttccccgaaaccaacaaaaacatt
gtgattgcagagtcgagacctccagaaactagatttccactagatggcgcatccgatgca
gatattggaatcaattccgccttgacctaccgattggatcccagtgattattttgctttg
gccacgcaaaacaatcgtgagcgaccttcttcattatccctcgtgttaaagaaatcatta
gacagagaagaaattcaggaacatagtttattactaacagctagtgacggaggcaaaccg
gaactgactggcacagttcagctgctgatcaccatcctcgacgtgaacgacaatgctcca
gagtttgataggttcgtttatagagttagagtgttagaggatgtatttaatggaacattg
gtgattaacttaaacgccacagatcccgacgagggtacaaatggagatataatctactcc
ttcaggcggcctgtatcccctgcggtagtgcatgcatttaatatagatcccaacagcgga
gaagttaggacaaaaggcctactggattttgaagaaattaaactgtatgaaatacccgtg
gaggcagtggataaagggaatatcccaatgacaggccattgtacccttctggtggaagta
ctagatgtaaacgacaatgcaccagaggtcacgatcacttccctgtcactaccagtcaaa
gaagatgctcagccaagcactgtcatagctctggtcagcgtgtctgaccgagactctggt
gacaacgggcaggtgacttgttctttgacaccgcacctccccttcaagctggtgtccact
ttcaagaattactattcattagtgttggacagcgccctggaccgtgagaccacagctgac
tataaggtggtggtgacagcccgagacgggggctcaccctctctgtgggccacggccagc
gtgtccgttgaggtggctgacgtgaacgacaacgtgcctgttttcgcgcagcctgaatac
accgtgtttgtgaaggagaacaacccgcctggcgcgcacatctttacggtgtctgcagtg
gacacagatgcgcaggagaacgcgctggtgtcctactcgctagtggagcggagggtaggc
gagcgcttgttgtcaagctatgtgtctgtgcacgctgaaagcggcaaggtatttgctctg
cagcctctggaccatgaggagctggagctgctgcagttccaggtgagcgcgcgggatgct
ggtgtgccagccctgggcagcaatgtgactctgcaggtgtttgtgctggatgagaacgac
aatgttcccacgctgctgcctcacagagctgtcggagctgggggggcagtgagtgagctt
gtgcctaggtcagtgggttcagggcatgtagtggcgaaggttcgcgcagtagatgcggac
tctggttacaatgcgtggctgtcttatgagctgcagttggcagcaggggccatgagcagt
ccgttccgcgtgggtctatacacgggcgagatcagcacgacgcgtgccctagatgaagca
gatgcaccgcgccagcgtctgttggtgttggtgaaggaccacggcgagcccgcgctaacc
gccacagccactgtgctggtgtctctggtggagaatggccaggcacccaaaatatcttcc
cttgcttccgagagcatagcatcttcggaggcgtctctggtgactgtcaacgtgtacctg
atcattgctatttgcgcggtgtccagcctgttggtgctcacgctactgctttacactgca
ctgcgctgctcagcaaggcccattaatggagcctgtgttccagggaagcccatgctggtg
tgctcaagcgcagtggggagctggtcctactcgcagcaaaggcgacagagggtgtgctct
ggagagggcccacctaagactgatcttatggccttcagtcccagtctccctcctgtgcta
ggctctgcagaggatacatgtcaaagagaaaggcaggtagaacatttgaaagagccccga
cagcccaaccctgactggcgctactctgcctcgctaagagccggcatgcacagctctgtg
cacctggaggaggctggcattctacgggctggtccaggagggcctgatcaacagtggcca
acagtatccagtgcaacaccagaaccagaggcaggagaggtgtcccctccagtgggcgct
ggtgtcaacagcaacagctggacctttaaatacggacccggcaaccccaaacagcccggt
cccggtgagttgccagacaaattcattatcccaggatctcctgcaatcatctccatccgg
caggagtctgctaacaaccaaattgacaaaagcgattttataaccttcggcaaaaaggag
gagaccaagaaaaagaagaaaaagaagaagggtaacaagacccaggagaaaaaagagaaa
gggaacagcacgacggacaacagtgaccagtga

DBGET integrated database retrieval system