KEGG   Rattus norvegicus (rat): 116744
Entry
116744            CDS       T01003                                 
Symbol
Lpar1
Name
(RefSeq) lysophosphatidic acid receptor 1
  KO
K04289  lysophosphatidic acid receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04072  Phospholipase D signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04540  Gap junction
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    116744 (Lpar1)
   04072 Phospholipase D signaling pathway
    116744 (Lpar1)
   04151 PI3K-Akt signaling pathway
    116744 (Lpar1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    116744 (Lpar1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    116744 (Lpar1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    116744 (Lpar1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    116744 (Lpar1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    116744 (Lpar1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    116744 (Lpar1)
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 116744
NCBI-ProteinID: NP_446388
RGD: 620563
Ensembl: ENSRNOG00000013656
UniProt: P61794
Position
5:complement(73229047..73347874)
AA seq 364 aa
MAAASTSSPVISQPQFTAMNEQQCFYNESIAFFYNRSGKYLATEWNTVSKLVMGLGITVC
VFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST
WLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA
IPSVGWNCICDIDHCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS
RHSSGPRRNRDTMMSLLKTVVIVLGAFIVCWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA
EFNSAMNPIIYSYRDKEMSATFRQILCCQRNENPNGPTEGSDRSASSLNHTILAGVHSND
HSVV
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggcagctgcctctacttccagccctgtgatttcacagccccagttcacagccatgaac
gaacaacagtgcttctacaacgagtctatcgccttcttctataaccggagtggaaagtat
ctagccacagaatggaacactgtgagcaagctggtgatgggactgggcatcactgtctgc
gtgttcatcatgctggccaatctactggtcatggtggcaatttacgtcaaccgccgcttc
catttccctatttattacttgatggccaacctggctgctgcagacttcttcgctggactg
gcctacttctacctgatgttcaacacgggacctaatacccggagactgaccgtgagcaca
tggcttctccggcagggcctcatcgacaccagcctgacggcttctgtggccaacctgctg
gccattgccatcgagaggcacatcacagttttccgaatgcagctccatacacgaatgagc
aaccgacgtgtggtggtggtgattgtagtcatctggactatggccattgtgatgggtgcc
atacccagtgtgggctggaactgcatctgtgatatcgatcattgttccaacatggcgccc
ctctacagtgactcctacttagtcttctgggccattttcaacctggtgacctttgtggtc
atggtggttctctacgctcacatctttggctatgttcgccagaggactatgagaatgtcc
cggcatagttctggacccaggaggaatcgggacaccatgatgagccttctgaagactgtg
gtcattgtgctgggtgcctttattgtctgctggactccgggattggtcttgctactgctc
gatgtgtgttgcccgcagtgcgatgtcctggcctatgagaagttcttcctcctcctggcc
gagttcaactcggctatgaaccccatcatctactcctaccgcgacaaagagatgagcgcc
accttcaggcagatcctgtgttgccagcgcaacgagaaccccaacggccccacggaaggc
tctgaccgctcggcctcctccctcaaccacactattctggctggagttcacagcaatgac
cactctgtggtttag

DBGET integrated database retrieval system