KEGG   Rattus norvegicus (rat): 116745Help
Entry
116745            CDS       T01003                                 

Gene name
Kcnh6, Erg2
Definition
(RefSeq) potassium voltage-gated channel subfamily H member 6
  KO
K04909  potassium voltage-gated channel Eag-related subfamily H member 6
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    116745 (Kcnh6)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   116745 (Kcnh6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PAS_9 cNMP_binding Ion_trans_2 PAS PAS_3 PAS_8 PAS_4 PAN_3
Motif
Other DBs
NCBI-GeneID: 116745
NCBI-ProteinID: NP_446389
RGD: 620304
Ensembl: ENSRNOG00000008078
Vega: OTTRNOG00000002216
UniProt: O54853
Position
10q32.1
AA seq 950 aa AA seqDB search
MPVRRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVM
QRPCTCDFLTGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDG
AVIMFILNFEDLAQLLAKSSSRSLTQRLLSHSFLGSEGSHSRPSGQGPGPGRGKYRTVSQ
IPQFTLNFVEFNLEKHRSGSTTEIEIIAPHKVVERTQNVTEKVTQVLSLGADVLPEYKLQ
APRIHRGTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLSDQDESQRGTCGYTCSPL
TVVDLIVDIMFVVDIVINFRTTYVNTNDEVVSHPRRIAVHYFKGWFLIDMVAAIPFDLLI
FRTGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWY
AIGNVERPYLEPKIGWLDSLGAQLGKQYNGSDPASGPSVQDKYVTALYFTFSSLTSVGFG
NVSPNTNSEKVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQ
IPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLHRALLQHCPAFRGASK
GCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRDDVVVAILGKNDIFGEP
ASLHARPGKSSADVRALTYCDLHKIHRADLLEVLDMYPAFADTFWNKLEVTFNLRDADGG
LQSTPRQAPGHQDPQGFFLNDSQSGAAPSLSISDTSALWPELLQQMPPSPPNPRQDLDCW
HRELGFKLEQLQAQMNRLESRVSSDLSRILQLLQHPQGRPSYILGASASSDLASFPETSV
TRSSESTLLVGHVPSAQTLSYGDLDDHIQTPRNFSPRTPHVAMAMDKTLVPSSEQEQPGG
LLSPLASPLRPLEVPGLGGSRFPSLPEHLSSVPKQLEFQRHGSDPGFTRS
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atgccagtccgcaggggccacgttgctccccaaaacacttacttggacaccatcatccgc
aagtttgaaggccagagtcggaagttcctgattgccaatgcgcagatggagaactgtgcc
atcatttactgcaacgatggcttctgcgaactctttggctactcccgtgtggaggtgatg
cagcggccctgtacttgtgatttcctcacgggcccgaacactccaagcagtgctgtgtcc
cgcttggctcaggccctgctcggggctgaagagtgcaaggtggacatcctctactatcgc
aaggacgcctccagcttccgctgcctggtggatgtggtccccgtgaagaatgaggacggg
gcagtcatcatgtttatcctcaatttcgaggacctggcccagctcctggccaaaagcagc
agccgcagcctgacccaacggttgttgtcacacagcttcctgggttctgagggctctcac
agcaggccgagtggacaggggcctggcccaggcaggggcaaatacagaaccgtcagccag
attccgcagttcacactcaacttcgtggagttcaacctggagaagcaccgctcaggctcc
accacggagattgagatcatcgctccgcacaaggtggtggagcggacacagaatgtcact
gaaaaagtcacccaggtcctgtccctaggtgcagatgtgctgccagagtacaagctacaa
gcaccgcgtatccaccgaggcaccattctgcactacagccccttcaaggccgtgtgggac
tggctaatcttgctcttagtcatctatacagcggtcttcacgccctactctgccgccttt
ctactcagcgaccaggacgaatcacagcgcggtacctgtggctatacctgcagcccgctc
accgtggtggacctcatcgtggatatcatgtttgtcgtggacatcgtcatcaacttccga
accacctacgtcaacactaatgatgaggtggtcagccacccacgacgcatcgctgtccac
tatttcaagggctggttcctcattgacatggtggctgccatcccctttgacctgcttatc
ttccgcactggctcagatgagaccaccaccttgattgggttactgaagacggcgcgcctc
ctgcggctggtgcgcgtggcccggaagctggaccgctattctgaatacggggccgcggta
ctcttcctgctcatgtgtactttcgcgctcattgcgcactggctggcctgtatctggtac
gccatcggcaacgtggagcgaccctacttggagcccaagatcggctggctggacagcctg
ggtgcacagcttggcaagcagtataatggcagcgacccagcctcaggaccctctgtccag
gacaagtatgtcaccgccctctacttcaccttcagcagccttaccagtgtgggcttcggc
aacgtgtcacccaacaccaactctgagaaggtcttctctatctgcgtcatgctcattggc
tcccttatgtacgccagcatctttggcaacgtgtcggccatcatccaacgcctgtactcg
ggcactgcccgctaccacacgcagatgctgcgtgtcaaggagttcatccgcttccaccag
atccccaacccactgcggcagcgcctggaagagtatttccagcacgcctggtcctacacc
aacggcattgacatgaacgcggtgctgaagggcttccctgagtgcctgcaggcggacatc
tgcctgcacctgcaccgcgctctgctgcagcactgccccgccttccggggcgccagcaag
gggtgcctgcgcgcgctcgcggtcaagttcaagaccacgcacgcgccgcctggggacacg
ctggtgcacctgggcgacgtgctctccacgctctacttcatctcccgcggctccatcgag
atcctgcgcgatgatgtggtcgtggccattctagggaagaatgacatctttggggagcct
gccagtcttcatgccaggccaggcaaatctagcgcagatgtgcgcgccctgacctactgc
gacctgcataagatccatcgagcagacctgctggaggtgctggacatgtaccctgccttt
gcagacaccttctggaataagctggaggtcaccttcaacctgcgggacgcagatgggggt
ctccagtcaacaccccgacaggccccaggccaccaagacccccaaggcttcttcctcaat
gacagtcagtcaggtgccgccccttccttgagcatttcagacacatctgcactttggcct
gaattgctacagcaaatgcccccaagtcccccaaacccacgacaggacctggattgctgg
catcgggagctaggctttaagttagaacagctccaagcccagatgaacagattggagtcc
cgtgtgtcatcagacctcagccgcatcctacagctgcttcagcacccgcagggtcgcccc
agctacatcttgggagcctctgcctccagtgacctggcctcatttcctgaaacttcagtg
actcggagttcagagtctacgcttctggtgggacatgtgccctctgctcagaccctaagc
tacggtgacttggacgaccatattcagacacccaggaatttctcccccaggacacctcac
gtggccatggcaatggacaaaactctggtgccatcctcagaacaagagcaacctgggggt
ctcctgtcacctctagcctcacctctgcgtcccctggaagtaccgggactgggtggttcc
cgcttcccctccctccctgaacacctcagctcagttcccaagcagctagagttccagaga
cacggttccgatcctggattcacaaggagttag

DBGET integrated database retrieval system