KEGG   Rattus norvegicus (rat): 116967
Entry
116967            CDS       T01003                                 

Gene name
Magt1
Definition
(RefSeq) magnesium transporter protein 1 precursor
  KO
K19478  magnesium transporter 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    116967 (Magt1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC58: MagT-like magnesium transporter
   116967 (Magt1)
SSDB
Motif
Pfam: OST3_OST6 Thioredoxin DUF4131
Other DBs
NCBI-GeneID: 116967
NCBI-ProteinID: NP_446398
RGD: 620094
Ensembl: ENSRNOG00000051408
Vega: OTTRNOG00000001768
UniProt: O35777
Position
X
AA seq 335 aa
MASPRWLWCVCATAAVTLLLVSKVPSASAQRKKEMVLAEKVSQLMEWTNKRPVIRMNGDK
FRRLVKAPPRNYSVIVMFTALQLHRQCVVCKQADEEFQILANSWRYSSAFTNRIFFAMVD
FDEGSDVFQMLNMNSAPTFINFPPKGKPKRADTYELQVRGFSAEQIARWIADRTDVNIRV
IRPPNYAGPLMLGLLLAVIGGLVYLRRSNMEFLFNKTGWAFAALCFVLAMTSGQMWNHIR
GPPYAHKNPHTGHVNYIHGSSQAQFVAETHIVLLFNGGVTLGMVLLCEAAASDMDIGKRR
MMCIAGIGLVVLFFSWMLSIFRSKYHGYPYSFLMS
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggcctcgccgaggtggctctggtgtgtgtgtgcgaccgcagcggtcacactgctgctc
gtttccaaggttccttcggcctctgcccaaagaaagaaggagatggtgttagctgagaag
gttagtcagctgatggaatggaccaataaaagacctgtaataagaatgaatggagacaag
ttccgtcgccttgttaaagcaccaccaagaaattactctgttattgtcatgtttactgct
ctccaacttcatagacaatgtgtcgtttgcaagcaagctgatgaagaattccagattctg
gcaaattcttggcgatactccagtgcatttaccaaccggatattttttgccatggtggat
tttgatgaaggctctgatgtatttcaaatgctaaacatgaattcagctccaactttcatc
aactttcctccaaaaggaaaacccaaaagggctgatacatatgagttgcaggtgcgaggg
ttttcagctgaacagattgcccggtggatcgcagacagaactgacgtcaacattagagta
atcagacctccaaattatgctggacctctaatgttggggttgcttcttgctgttattggt
ggacttgtgtatctgcgacgaagtaatatggaattcctctttaataaaaccggatgggct
tttgcagcattgtgttttgtacttgcaatgacatctggccaaatgtggaaccatataaga
ggaccaccatatgctcataagaatccccatacaggacatgtgaattatatccacggaagc
agccaagcacagtttgtagctgaaacccacattgttcttctcttcaatggtggggttacc
ttaggtatggtgcttttatgtgaagctgctgcctctgacatggatattgggaagcgaagg
atgatgtgtattgctgggattggacttgttgtgttattcttcagttggatgctgtccatc
tttcgatcaaaataccatggctatccatacagctttctgatgagttaa

DBGET integrated database retrieval system