KEGG   Rattus norvegicus (rat): 117017
Entry
117017            CDS       T01003                                 

Gene name
Polr2g
Definition
(RefSeq) DNA-directed RNA polymerase II subunit RPB7
  KO
K03015  DNA-directed RNA polymerase II subunit RPB7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    117017 (Polr2g)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    117017 (Polr2g)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    117017 (Polr2g)
   03019 Messenger RNA biogenesis [BR:rno03019]
    117017 (Polr2g)
   03400 DNA repair and recombination proteins [BR:rno03400]
    117017 (Polr2g)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     117017 (Polr2g)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     117017 (Polr2g)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      117017 (Polr2g)
SSDB
Motif
Pfam: S1 SHS2_Rpb7-N
Other DBs
NCBI-GeneID: 117017
NCBI-ProteinID: NP_446400
RGD: 621284
Ensembl: ENSRNOG00000019439
UniProt: P62489
Position
1
AA seq 172 aa
MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
PNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS
NT seq 519 nt   +upstreamnt  +downstreamnt
atgttttatcatatttccctggagcacgagatcctactgcacccacgctactttggtccc
aacttgctcaacacggtgaagcagaagctgttcaccgaggtggaggggacctgcactggg
aaatatggctttgtgattgctgtcactaccatcgacaatattggtgctggtgtgatccag
ccgggccgaggttttgttctttatccagtgaaatacaaagctattgttttccggcccttt
aaaggggaagtggtggatgctgtggtcactcaggtcaacaaggttggacttttcacagaa
attgggcccatgtcctgcttcatctctcgacactccatcccttcagagatggagtttgat
ccaaattcgaaccccccttgttacaagaccatggatgaggacattgtaattcagcaggac
gatgagatacgcttgaagattgtagggacacgtgtagacaagaatgacatttttgctatt
ggctctctgatggatgactacttgggacttgtgagctga

DBGET integrated database retrieval system