KEGG   Rattus norvegicus (rat): 117019
Entry
117019            CDS       T01003                                 

Gene name
Eif2b4, Eif2b
Definition
(RefSeq) eukaryotic translation initiation factor 2B subunit delta
  KO
K03680  translation initiation factor eIF-2B subunit delta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    117019 (Eif2b4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    117019 (Eif2b4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rno03012]
    117019 (Eif2b4)
Translation factors [BR:rno03012]
 Eukaryotic type
  Initiation factors
   eIF-2B
    117019 (Eif2b4)
SSDB
Motif
Pfam: IF-2B DUF1233
Other DBs
NCBI-GeneID: 117019
NCBI-ProteinID: NP_446402
RGD: 620208
Ensembl: ENSRNOG00000005301
UniProt: Q63186
Position
6q14
AA seq 524 aa
MAAVAVAVREESRSEMKTELSPRPGAAGRELTQEEKLQLRKEKKQQKKKRKEEKGADQEI
GSAVSAAQRQDPVRELQGTGSQLGGTTGEKLPAGRSKAELRAERRAKQEAERALKQARKG
EQGGPSPQACPSTAGEATSGVKRVPEHTQADDPTLLRRLLRKPDRQQVPTRKDYGSKVSL
FSHLPQYSRQSSLTQYMSIPSSVIHPAMVRLGLQYSQGLVSGSNARCIALLHALQQVIQD
YTTPPNEELSRDLVNKLKPYISFLTQCRPMSASMCNAIKFFNKEVTGMSSSKREEEAKSE
LKEAIDRYVQEKIVLASQAISRFASKKISDGDVILVYGCSSLVSRILQEAWVEGRRFRVV
VVDSRPRLEGRHMLHCLVRAGVPTSYLLIPAASYVLPEVSKVLLGAHALLANGSVMSRVG
TAQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGDQVTLANWQNN
SSLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggctgcggtggcggtggctgttcgcgaagaatcgagatccgagatgaagacagaactt
tcacctcggcccggggcagcggggcgggagttgacccaagaagagaagcttcagcttcgg
aaagaaaagaaacagcagaagaagaaacggaaggaggaaaagggggcagaccaagaaatt
ggctctgctgtatctgcagctcaacgtcaagacccagtcagagaacttcaaggaactggt
agtcagttgggaggcactactggggagaaacttccagctggccggagtaaggcagaactt
cgagcagaaaggagagccaagcaggaggcagagcgggccctgaaacaggccagaaaaggg
gaacaaggaggaccctctcctcaggcctgccccagcacagctggagaagccacctcagga
gtgaagcgtgtccctgagcacacccaggctgatgaccccacacttctgaggaggctcctt
agaaagccagatcgacaacaggttcctacaagaaaggattatggatccaaagtcagtctc
ttctcccacctaccccagtacagcagacaaagctccttaacccagtacatgagcatccca
tcctctgtgatccacccagccatggtgcgactcggtctgcagtactcccagggccttgtc
agtggctccaatgcccggtgcatagcgctgctccacgctctgcagcaggtgattcaggat
tacacaacacctcccaatgaggaactctccagggatcttgtaaataaactaaaaccctac
atcagcttcctgacccagtgccgccccatgtcggccagcatgtgtaacgccatcaagttc
tttaacaaggaagtcactggtatgagcagctccaagcgggaagaagaggccaagtcagaa
cttaaagaagccatcgatcggtatgtgcaagagaagattgtgcttgcatctcaggcaatt
tcacgatttgcttctaagaagatcagtgatggggacgtgatcctagtatatggatgctca
tctctggtgtcgagaattctccaggaggcctgggttgagggcaggcgcttccgggtggtg
gtggtagacagccggccccggctggagggaaggcatatgctccactgtctggtccgtgct
ggggtccctacctcctatctgctgattcctgcggcctcctatgtgctcccagaggtttct
aaggtgctattgggagctcatgcactcctggccaatggatctgtgatgtcgagggtaggg
acagcacagttggccctggtggcccgagctcataatgttccagtactggtctgctgtgaa
acatacaagttctgtgaacgcgtgcagaccgatgcctttgtctccaacgagctagatgac
cctgacgatctccagtgtaagcggggagaccaggtgaccctggcgaactggcagaacaac
tcatcactccggttgttgaatctggtctatgacgtgactccccccgagcttgtggatctg
gtgatcacagagttgggcatgatcccttgcagttctgtgcctgttgtcctccgagtcaag
agtagtgaccaatga

DBGET integrated database retrieval system