KEGG   Rattus norvegicus (rat): 117021
Entry
117021            CDS       T01003                                 

Gene name
Nup155
Definition
(RefSeq) nuclear pore complex protein Nup155
  KO
K14312  nuclear pore complex protein Nup155
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    117021 (Nup155)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    117021 (Nup155)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    117021 (Nup155)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     117021 (Nup155)
SSDB
Motif
Pfam: Nucleoporin_N Nucleoporin_C
Other DBs
NCBI-GeneID: 117021
NCBI-ProteinID: NP_446404
RGD: 621199
Ensembl: ENSRNOG00000013411
UniProt: P37199
Position
2
AA seq 1390 aa
MPSMLGSMMVASTSAPSLQEALENAGRLIDRQLQEDRMYPDLSELLMVSAPNSPTVSGMS
DMDYPLQGPGLLSVPSLPEISTIRRVPLRLSWLNSLDTCSVTAMMGVFPPISRAWLTIDS
DIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGIFQPHVRHLLVLATPVDIVILGLSYA
NVQTGSGILNDSVCGGLQLLPDPLYSLPTDNTYLLTITSTDNGRIFLAGKDGCLYEVAYQ
AEAGWFSQRCRKINHSKSSLSFLVPSLLQFTFSEDDPIVQIEIDNSRNILYTRSEKGVIQ
VYDLGHDGQGMSRVASVSQNAIVCAAGNIARTIDRSVFKPIVQIAVIENSESLDCQLLAV
THAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASSTVEKPSKVHKALYSKGILLMT
ASENEDNDILWCVNHDTFPFQKPMMETQMTTRVDGHSWALSAIDELKVDKIITPLNKDHI
PITDSPVVVQQHMLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFKL
HQEDQACATCLILACSTAACDREVSAWATRAFFRYGGEAQMRFPATLPTPSNVGPILGSP
MYSSSPVPTGSPYPNPSSLGTPSHGAQPPTMSTPMSAVGNPAMQAASLSGLTGPEIVYSG
KHNGICIYFSRIMGNIWDASLVVERVFKSSNREITAIESSVPIQLLESVLQELKGLQEFL
DRNSQFSGGPLGNPNTTAKVQQRLLGVMRPENGNTQQMQQELQRKFHEAQLSEKISLQAI
QQLVRKSYQALALWKLLCEHQFTVIVGELQKEFQEQLKITTFKDLVIREKEVTGALIASL
INCYIRDNAAVDGISLHLQDTCPLLYSTDDAVCSKANELLQRSRQVQSKSERERMLRESL
KEYQKISNQVDLPSVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDVVG
LQTFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHFE
QMLKLAQRSKDELFSIALYNWLIQADLADKLLQIASPFLEPHLVRMAKVDQNRVRYMDLL
WRYYEKNRSFSSAARVLSKLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEFL
HELEEKMEVARIQLQIQETLQRQYSHHSSVQDAISQLDSELMDITKLYGEFADPFKLAEC
KLAIIHCAGYSDPILVHTLWQDIIEKELSDSVTLSSSDRMHALSLKLVLLGKIYAGTPRF
FPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRVKSPL
HLLDCIHVLLTRYVENPSLVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNFK
SLQAKLERLH
NT seq 4173 nt   +upstreamnt  +downstreamnt
atgccatctatgctgggctcgatgatggtggcctctacgtcggccccctccctgcaagaa
gctttggaaaatgcggggaggcttatcgaccgacagttgcaagaagaccgcatgtacccg
gacctttctgagctgctcatggtgtcggccccaaacagtcctactgtttctggaatgtct
gatatggattaccctctgcaaggaccaggtctactgtcagtaccgagccttccagagatc
agcaccatccgaagagttcccctccgcctgagctggttgaacagtttggacacatgcagt
gtaactgcaatgatgggtgttttccctcctatcagcagagcttggcttacaattgacagt
gacatattcatgtggaactatgaagacggaggtgatcttgcctattttgatggactcagt
gagacaattcttgctgtggggcttgtgaaaccaaaagctggaatctttcaacctcatgta
agacatttgttggttttggcaacacctgtggatatagtaattcttggactcagctatgct
aatgttcagacaggctctggcatccttaatgacagtgtgtgtggtggcctgcagctgctt
ccagatcctttgtactcccttcccacggacaacacttaccttttaactatcacctccacg
gataatggcaggatttttttggctggaaaggacggctgtttgtatgaagtagcataccaa
gcagaagcaggctggttcagtcaaagatgtaggaagataaaccactccaagagctcgctc
tccttcctcgtgccttccttgctgcagttcaccttctcagaagatgatcctattgttcaa
attgaaattgataattccagaaatattttgtatacccgatcggagaaaggagtgatacag
gtttatgatttgggccatgatggacaggggatgagtagagttgcttcagtttcacagaat
gccattgtctgtgctgctgggaacattgctaggactatcgatcgttccgtttttaagcca
attgttcaaatagctgtgattgagaactctgaatcattggactgtcagttactggctgtc
actcatgcaggtgtgaggttgtatttcagcacttgtccgtttagacagccattagctcgg
cccaatacactgacactggttcacgtccggttacctcctggcttctcagcgtcttcaaca
gttgaaaagccttcaaaagtacataaagcactttacagtaaaggaattttactgatgaca
gcctcagaaaatgaagataatgacattttatggtgtgtcaaccatgatacatttcctttc
caaaagccaatgatggaaactcagatgacaactcgtgttgatggccattcctgggctctt
tctgcaatagatgaattaaaagtagataaaataatcacgcctttaaataaagatcatatt
ccaataactgactccccagttgttgtacaacagcacatgttgcctccaaagaaattcgtt
ctcctctcagcacagggtagtcttatgtttcacaaacttagacccgtagatcagctgaga
catctgcttgtgagtaacgtgggaggggatggagaagagattgagagattcttcaaatta
catcaggaagaccaagcttgtgcgacgtgccttattcttgcttgttccaccgctgcctgt
gacagagaggtgtctgcctgggctacgagggcattctttaggtatggtggtgaggcacag
atgagatttccagctactcttcccactccgagtaacgttggtcccatcctgggctctcct
atgtattctagttctcctgttcctactgggagtccctatccaaatccttcctctttgggg
acaccatcccatggtgctcagcctcctaccatgtcaaccccaatgtctgctgttggaaac
ccagccatgcaggctgcaagcctgagtggtttgactggaccagagattgtgtactcagga
aaacacaacggtatttgcatttacttttctcgaatcatgggaaatatttgggatgctagc
ttagttgttgaaagagtattcaagagttccaacagggagatcactgcaattgaaagcagt
gtgcctatccagctgctggagtcagtgctacaggaactgaagggtttgcaggaatttcta
gacagaaattctcagttttcaggaggaccactaggaaatccaaataccactgccaaagtg
cagcagaggctgcttggagtcatgcgtcccgagaatggaaacacccagcaaatgcaacag
gagctgcagaggaagtttcatgaggctcaactgagtgagaagatttcacttcaggcaatc
cagcagctagttagaaaatcgtaccaagctctggctttgtggaaactcctttgtgaacat
cagtttactgtcattgtaggagaacttcaaaaggaatttcaagagcagctgaagatcact
acctttaaggatctggtaatcagggagaaagaggtcactggagcactaattgcttctctc
atcaactgctacatcagagacaatgctgctgtagatggcattagtttacatctgcaggac
acctgtccgcttctgtatagcacagatgatgcagtttgttccaaggcaaatgaacttctt
cagcgttcccggcaagttcagagtaagagcgagagagagaggatgttgagggagtctctg
aaggagtaccagaaaatcagcaaccaagtagacctccccagtgtgtgtgctcagtatcgg
caagtgcgcttttatgagggtgtggtggaactgtctcttactgctgcggagaagaaagat
cctcagggtcttggactccatttctataagcatggggaaccggaagaggatgtggttggt
cttcagactttccaagagagattaaacagttacaagtgcatcacagacactcttcaagaa
ctggtaaatcaaagtaaggcagctcctcagtctcctagtgtacccaaaaagcctggtcct
ccagtgttgtcatccgatcccaacatgctgagcaatgaagaggcaggacatcactttgaa
caaatgcttaaactggctcagcgatccaaggatgagctcttcagtattgctctctataac
tggctaatccaagctgaccttgcagataaactgctacagattgcatctccatttcttgag
ccacatcttgtccgaatggccaaagtggatcaaaaccgagttcgctatatggatttactc
tggaggtattatgagaagaacaggagtttcagcagtgctgctcgggtcctgtccaagctg
gccgacatgcacagcacagaaatttcactgcagcagcgactagaatacattgctcgagcc
attcttagtgcaaaaagttccactgccatttcatccatagctgcagatggtgaattccta
catgaactagaagagaaaatggaagttgctaggatccaacttcagatacaagagacacta
caaaggcagtactcccatcattcttcagtgcaggatgcaatttctcagctggattctgag
ctcatggacattactaagctttatggagaatttgctgacccatttaaacttgcagaatgt
aaacttgcaatcattcattgtgctggttattcagatcccatattggtacacacactttgg
caagatatcatagagaaagaattgagtgatagcgtaacattgagttcatcagatcgaatg
catgctcttagcctcaagcttgttctccttggcaaaatctatgctggcacacctcgattt
ttccctctggatttcattgtgcagttcttggagcagcaagtttgtactttaaactgggat
gtgggatttgtgatacagaccatgaatgaaatcggtgtgcctttacctaggctactagaa
gtttatgatcagctcttcaaatcaagggatccattctggaacagagtgaaaagtccactg
caccttttggattgtatccatgtactgttgacaagatatgttgagaatcctagcctagtt
ttaaattgtgagaggagaaggtttacaaatctctgcctggatgccgtctgtggttatctg
gttgaacttcagtcaatgagctcttcggtggcagtacaagccatcactgggaattttaaa
tctctccaagcgaagttggaacggctccattaa

DBGET integrated database retrieval system