KEGG   Rattus norvegicus (rat): 117022Help
Entry
117022            CDS       T01003                                 

Gene name
Il1r2
Definition
(RefSeq) interleukin 1 receptor type 2
  KO
K04387  interleukin 1 receptor type II
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04640  Hematopoietic cell lineage
rno05146  Amoebiasis
rno05166  Human T-cell leukemia virus 1 infection
rno05202  Transcriptional misregulation in cancer
rno05215  Prostate cancer
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    117022 (Il1r2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    117022 (Il1r2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    117022 (Il1r2)
  09162 Cancer: specific types
   05215 Prostate cancer
    117022 (Il1r2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    117022 (Il1r2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    117022 (Il1r2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    117022 (Il1r2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    117022 (Il1r2)
   04090 CD molecules [BR:rno04090]
    117022 (Il1r2)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IL1 receptor family
   117022 (Il1r2)
CD molecules [BR:rno04090]
 Proteins
  117022 (Il1r2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ig Ig_3 I-set Ig_6 Ig_2 V-set Izumo-Ig IL3Ra_N
Motif
Other DBs
NCBI-GeneID: 117022
NCBI-ProteinID: NP_446405
RGD: 621147
Ensembl: ENSRNOG00000014378
UniProt: P43303
Position
9q22
AA seq 416 aa AA seqDB search
MFILLVLVTGVSAFTTPAVVHTGRVSESPVTSEKHPVLGDDCWFRGRDFKSELRLEGEPV
VLRCPLVPHSDTSSSSRSLLTWSKSDSSQLIPGDEPRMWVKDDTLWVLPAVQQDSGTYIC
TFRNASHCEQMSLELKVFKNTEASFPLVSYLQISALSSTGLLVCPDLKEFISSRTDGKIQ
WYKGSILLDKGNKKFLSAGDPTRLLISNTSMGDAGYYRCVMTFTYEGKEYNITRNIELRV
KGITTEPIPVIISPLETIPASLGSRLIVPCKVFLGTGTSSNTIVWWMANSTFISVAYPRG
RVTEGLHHQYSENDENYVEVSLIFDPVTKEDLNTDFKCVATNPRSFQSLHTTVKEVSSTF
SWGIALAPLSLIILVVGAIWIRRRCKRQAGKTYGLTKLPTDNQDFPSSPNQIKEMK
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgttcatcttgcttgtgttagtaactggggtttcagctttcaccactccagcagtggtg
cacacaggaagggtttctgagtctcccgttacatcagagaagcacccagttcttggagac
gattgctggtttcgtggcagagatttcaaatcggaattgaggctggaaggtgagcccgtg
gtcctgaggtgccccctggtacctcattcagacacctccagcagttcccgcagccttctg
acatggagtaaatcggactcttctcagctgatcccaggagatgagccaaggatgtgggtg
aaggatgatacgctctgggttctgccagcagttcagcaggactctggtacctacatctgc
acattcagaaacgcgtcccactgtgaacaaatgtctctggaactcaaggtctttaagaat
accgaagcctctttccctctcgtctcctacttgcaaatctcagctctctcctccaccggg
ttacttgtgtgccctgacctgaaagagttcatctccagcagaactgatggaaagatacag
tggtataagggctccatcctcttggataaaggcaataagaaatttctgagtgcgggagac
cccacacgcctattgatatccaacacatccatgggagatgcaggctattacagatgtgtt
atgacatttacctacgagggcaaggaatacaacatcactaggaatattgaactccgggtc
aaaggaataaccacagaacccatccctgtgatcatttctcccctggagacaataccagca
tctttggggtcaagactgatagtcccgtgcaaggtgttcctgggaactggtacatcttcc
aacaccatcgtgtggtggatggctaacagcacgtttatctcagtggcctacccaagaggc
cgtgtgactgaggggctacaccaccagtactcagagaatgatgagaactacgtggaagtg
tcgctgatttttgatccagtcacaaaggaggatctaaatacagattttaaatgtgttgcc
acgaatccacggagttttcagtcactccataccacagtcaaagaagtttcttccacgttc
tcctggggcatcgcgctggcacctctgtctctgatcatcttggttgtgggggcgatatgg
attcgcagaaggtgtaaacgccaggctggaaagacgtatgggctgaccaagctaccgact
gacaaccaggacttcccttccagcccaaaccaaataaaggaaatgaaataa

DBGET integrated database retrieval system