KEGG   Rattus norvegicus (rat): 117027Help
Entry
117027            CDS       T01003                                 

Gene name
Ccr3, Cmkbr3
Definition
(RefSeq) C-C motif chemokine receptor 3
  KO
K04178  C-C chemokine receptor type 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    117027 (Ccr3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    117027 (Ccr3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    117027 (Ccr3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    117027 (Ccr3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    117027 (Ccr3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    117027 (Ccr3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    117027 (Ccr3)
   04050 Cytokine receptors [BR:rno04050]
    117027 (Ccr3)
   04090 CD molecules [BR:rno04090]
    117027 (Ccr3)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    117027 (Ccr3)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CC Chemokine
   117027 (Ccr3)
CD molecules [BR:rno04090]
 Proteins
  117027 (Ccr3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 117027
NCBI-ProteinID: NP_446410
RGD: 620593
Ensembl: ENSRNOG00000006736
UniProt: O54814
Position
8q32
AA seq 359 aa AA seqDB search
MASNEEELKTVVETFETTPYEYEWAPPCEKVSIRELGSWLLPPLYSLVFIVGLLGNMMVV
LILIKYRKLQIMTNIYLLNLAISDLLFLFTVPFWIHYVLWNEWGFGHCMCKMLSGLYYLA
LYSEIFFIILLTIDRYLAIVHAVLALRARTVTFATITSIITWGLAVLAALPEFIFHESQD
NFGDLSCSPRYPEGEEDSWKRFHALRMNIFGLALPLLIMVICYSGIIKTLLRCPNKKKHK
AIQLIFVVMIVFFIFWTPYNLVLLLSAFHSTFLETSCQQSIHLDLAMQVTEVITHTHCCI
NPIIYAFVGERFRKHLRLFFHRNVAIYLRKYISFLPGEKLERTSSVSPSTGEQEISVVF
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcatccaacgaagaggaactcaagactgttgttgaaacctttgagaccacaccctat
gaatatgagtgggcaccaccctgtgaaaaagtcagcatcagagagctggggtcatggctc
ctgcctccactgtattccctggtgttcatcgtcggcctcctgggcaacatgatggttgtg
ttgatcctcataaagtacaggaagctgcaaattatgactaatatctacctactcaacttg
gcaatttctgacctgctctttctcttcactgtcccattctggattcactatgttctgtgg
aatgagtggggttttggccactgcatgtgtaaaatgctctctgggctttattacctggcc
ttgtacagcgagatctttttcatcatcctgctgacaatcgacaggtacctggctatcgtt
catgctgtgttggcccttcgagcacgaactgtgacttttgctactatcaccagcatcatc
acttggggtcttgcagtattggcagcattgcctgaatttatcttccatgagtcccaagac
aattttggagatctttcctgcagtcctcgctatccagagggcgaagaagacagctggaag
cgtttccatgctctaagaatgaacatttttggtttagctcttcctctcctcattatggtt
atctgctactcaggaatcattaaaactctgcttagatgccccaataaaaaaaaacacaag
gccatccagcttatttttgttgtcatgatagtcttttttattttttggactccatacaac
ctggttcttcttctgtctgctttccacagcacatttttggagaccagctgtcagcagagc
atacacctggacctggccatgcaagtgactgaggtgattacccacacccactgctgtatc
aatccaataatctatgcctttgttggtgagaggttccggaaacaccttcggctctttttc
cacagaaatgtggcaatctacctgagaaaatatatttcattccttcctggcgagaaactg
gaaagaacaagctctgtctccccatcaactggggagcaagaaatctctgtggtgttttag

DBGET integrated database retrieval system