KEGG   Rattus norvegicus (rat): 117027
Entry
117027            CDS       T01003                                 

Gene name
Ccr3
Definition
(RefSeq) C-C chemokine receptor type 3
  KO
K04178  C-C chemokine receptor type 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    117027 (Ccr3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    117027 (Ccr3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    117027 (Ccr3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    117027 (Ccr3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    117027 (Ccr3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    117027 (Ccr3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    117027 (Ccr3)
   04050 Cytokine receptors [BR:rno04050]
    117027 (Ccr3)
   04090 CD molecules [BR:rno04090]
    117027 (Ccr3)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    117027 (Ccr3)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CC Chemokine
   117027 (Ccr3)
CD molecules [BR:rno04090]
 Proteins
  117027 (Ccr3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 117027
NCBI-ProteinID: NP_446410
RGD: 620593
Ensembl: ENSRNOG00000006736
UniProt: O54814
Position
8
AA seq 359 aa
MASNEEELKTVVETFETTPYEYEWAPPCEKVSIRELGSWLLPPLYSLVFIVGLLGNMMVV
LILIKYRKLQIMTNIYLLNLAISDLLFLFTVPFWIHYVLWNEWGFGHCMCKMLSGLYYLA
LYSEIFFIILLTIDRYLAIVHAVLALRARTVTFATITSIITWGLAVLAALPEFIFHESQD
NFGDLSCSPRYPEGEEDSWKRFHALRMNIFGLALPLLIMVICYSGIIKTLLRCPNKKKHK
AIQLIFVVMIVFFIFWTPYNLVLLLSAFHSTFLETSCQQSIHLDLAMQVTEVITHTHCCI
NPIIYAFVGERFRKHLRLFFHRNVAIYLRKYISFLPGEKLERTSSVSPSTGEQEISVVF
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcatccaacgaagaggaactcaagactgttgttgaaacctttgagaccacaccctat
gaatatgagtgggcaccaccctgtgaaaaagtcagcatcagagagctggggtcatggctc
ctgcctccactgtattccctggtgttcatcgtcggcctcctgggcaacatgatggttgtg
ttgatcctcataaagtacaggaagctgcaaattatgactaatatctacctactcaacttg
gcaatttctgacctgctctttctcttcactgtcccattctggattcactatgttctgtgg
aatgagtggggttttggccactgcatgtgtaaaatgctctctgggctttattacctggcc
ttgtacagcgagatctttttcatcatcctgctgacaatcgacaggtacctggctatcgtt
catgctgtgttggcccttcgagcacgaactgtgacttttgctactatcaccagcatcatc
acttggggtcttgcagtattggcagcattgcctgaatttatcttccatgagtcccaagac
aattttggagatctttcctgcagtcctcgctatccagagggcgaagaagacagctggaag
cgtttccatgctctaagaatgaacatttttggtttagctcttcctctcctcattatggtt
atctgctactcaggaatcattaaaactctgcttagatgccccaataaaaaaaaacacaag
gccatccagcttatttttgttgtcatgatagtcttttttattttttggactccatacaac
ctggttcttcttctgtctgctttccacagcacatttttggagaccagctgtcagcagagc
atacacctggacctggccatgcaagtgactgaggtgattacccacacccactgctgtatc
aatccaataatctatgcctttgttggtgagaggttccggaaacaccttcggctctttttc
cacagaaatgtggcaatctacctgagaaaatatatttcattccttcctggcgagaaactg
gaaagaacaagctctgtctccccatcaactggggagcaagaaatctctgtggtgttttag

KEGG   Rattus norvegicus (rat): 117029
Entry
117029            CDS       T01003                                 

Gene name
Ccr5
Definition
(RefSeq) C-C chemokine receptor type 5
  KO
K04180  C-C chemokine receptor type 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04144  Endocytosis
rno05145  Toxoplasmosis
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    117029 (Ccr5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    117029 (Ccr5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    117029 (Ccr5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    117029 (Ccr5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    117029 (Ccr5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    117029 (Ccr5)
   05163 Human cytomegalovirus infection
    117029 (Ccr5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    117029 (Ccr5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    117029 (Ccr5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    117029 (Ccr5)
   04050 Cytokine receptors [BR:rno04050]
    117029 (Ccr5)
   04090 CD molecules [BR:rno04090]
    117029 (Ccr5)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    117029 (Ccr5)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CC Chemokine
   117029 (Ccr5)
CD molecules [BR:rno04090]
 Proteins
  117029 (Ccr5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx 7TM_GPCR_Srab
Other DBs
NCBI-GeneID: 117029
NCBI-ProteinID: NP_446412
RGD: 620596
Ensembl: ENSRNOG00000049115
Vega: OTTRNOG00000001625
UniProt: O08556 Q68G28
Position
8
AA seq 354 aa
MDFQGSIPTYIYDIDYSMSAPCQKFNVKQIAAQLLPPLYSLVFIFGFVGNMMVFLILISC
KKLKSMTDIYLFNLAISDLLFLLTLPFWAHYAANEWVFGNIMCKLFTGIYHIGYFGGIFF
IILLTIDRYLAIVHAVFAIKARTVNFGVITSVVTWVVAVFVSLPEIIFMRSQKEGSHYTC
SPHFPRIQYRFWKHFQTLKMVILSLILPLLVMVICYSGILNTLFRCRNEKKRHRAVRLIF
AIMIVYFLFWTPYNIVLLLTTFQEYFGLNNCSSSNRLDQAMQVTETLGMTHCCLNPVIYA
FVGEKFRNYLSVFFRKHIVKRFCKHCSIFQQVNPDRVSSVYTRSTGEQEVSTGL
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggattttcaagggtcgattccaacctatatctatgacatcgattatagtatgtcagca
ccctgccaaaaattcaatgtgaaacaaattgcagcccagctcctgcccccactctactct
ctggtattcatctttggttttgtgggtaacatgatggtcttcctcatcctgataagctgc
aaaaagctgaagagcatgactgatatctacctgttcaacctggccatctctgacctgctc
ttcctgctcacactcccattctgggctcactatgctgcaaatgagtgggtctttgggaat
ataatgtgcaaattattcacagggatctatcacattggttattttggtggaatcttcttc
attatcctcctgacaattgataggtacttggctattgtccatgctgtgtttgctataaaa
gccagaacagtcaactttggggtaataacaagtgtagtcacttgggtggtggctgtgttt
gtctctctcccagaaataatctttatgagatctcaaaaagaaggttctcattatacatgc
agtcctcattttccacgtattcaatatcgtttctggaagcattttcaaacattaaagatg
gtcatcttgagcctgatcctacccctacttgtcatggtcatctgctattcaggaatcctc
aacaccctgtttcgctgtaggaatgagaagaagaggcacagggctgtaaggctcatcttt
gccatcatgattgtctactttctcttctggactccctacaacattgtcctcctcctgacc
accttccaggaatactttggactgaataattgcagtagttctaatagactagaccaggca
atgcaggtgacagagactcttgggatgacacactgctgcctcaaccctgtcatctatgcc
tttgttggggagaagttccggaattatctctctgtgttcttccgaaaacacattgtcaaa
cgcttctgcaaacactgttcaattttccagcaagtcaatcctgatcgtgtaagctcagtc
tatacccggtccacaggagaacaggaagtttctactggtttatga

KEGG   Rattus norvegicus (rat): 301088
Entry
301088            CDS       T01003                                 

Gene name
Ccr1l1
Definition
(RefSeq) C-C chemokine receptor 1-like protein 1
  KO
K04176  C-C chemokine receptor type 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    301088 (Ccr1l1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    301088 (Ccr1l1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    301088 (Ccr1l1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    301088 (Ccr1l1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    301088 (Ccr1l1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    301088 (Ccr1l1)
   04050 Cytokine receptors [BR:rno04050]
    301088 (Ccr1l1)
   04090 CD molecules [BR:rno04090]
    301088 (Ccr1l1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    301088 (Ccr1l1)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CC Chemokine
   301088 (Ccr1l1)
CD molecules [BR:rno04090]
 Proteins
  301088 (Ccr1l1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 301088
NCBI-ProteinID: NP_001100342
RGD: 1308007
Ensembl: ENSRNOG00000006730
UniProt: D3ZFW8
Position
8
AA seq 356 aa
MESPAVTESSYNTVAMNDFFSGFVCFSINVRAFGITVLTPLYSLVFVIGVIGNVLVVLVL
IQRKRLRNMTSIYLFNLAVSDLVFLFTLPFWVDYIVKGDWVFGNAMCKFLAGFYYLGLYS
DMFFITLLTIDRYLAVVHAVFALRARTVTFGIISSIITWVLATLVSIPCLYFFKTQLEFT
YQTCRAVLPKKSLIQFLRFQALTMNILGLILPLLAMIICYTRIINVLHRRPNKKKAKVMR
LIFVITLLFFLLLTPYYLAAFVSAFEDVLFTPGCVRSQQVDLALMITEALAYTHCCVNPV
IYVFVGERFRKYLRQLFWRRTAVSLPKWLPFHSVDRVQRSSSTSPSTGEIEVSADL
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggagagtccagctgtcacagagtcctcctataacacagttgccatgaatgacttcttt
tctggattcgtatgtttcagcataaatgtgcgggcatttggaatcacagtgctgactccg
ctgtactcgctggtgtttgtcattggtgtgataggcaatgtcctggtggttctggtgctc
atacaacgcaagaggcttcgaaacatgaccagcatctacctgttcaacctggctgtctct
gatctggtctttctattcacactacctttctgggttgactatatcgtaaaaggagactgg
gtgtttggtaatgccatgtgtaagtttctcgctggattttattacctgggcttgtatagt
gacatgttttttatcaccctgcttacaattgataggtacctagctgttgtccatgctgtg
tttgctctgagggcccggactgtcacttttggcatcatcagcagcatcattacctgggtc
ctagctaccttggtttctattccttgtctgtattttttcaaaactcagttggagttcact
taccaaacctgcagagcagttttgcccaagaagagcctgatacagtttttgaggtttcag
gctctcacaatgaacatccttgggctaattttgcctctgttggccatgatcatctgctat
acaaggatcatcaatgttctacacagaagacccaataagaagaaggccaaagtcatgcgt
ctgatttttgttattacacttctcttcttcctcctcttgaccccctattatttggctgcc
tttgtttctgcttttgaagacgtcctattcacccccgggtgtgtgagaagccaacaggtg
gacctggccttgatgataactgaggcacttgcctacacccactgctgtgtcaacccagtc
atttatgtctttgtgggtgaacggttccggaagtacctccggcagctgttttggaggcgt
acagctgtatccctgccaaaatggctgcccttccactcggtagaccgagtacagaggtcc
agttccacgtctccatccacaggggaaattgaggtctctgctgacttataa

KEGG   Rattus norvegicus (rat): 57301
Entry
57301             CDS       T01003                                 

Gene name
Ccr1
Definition
(RefSeq) C-C chemokine receptor type 1
  KO
K04176  C-C chemokine receptor type 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    57301 (Ccr1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    57301 (Ccr1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    57301 (Ccr1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    57301 (Ccr1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    57301 (Ccr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    57301 (Ccr1)
   04050 Cytokine receptors [BR:rno04050]
    57301 (Ccr1)
   04090 CD molecules [BR:rno04090]
    57301 (Ccr1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    57301 (Ccr1)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CC Chemokine
   57301 (Ccr1)
CD molecules [BR:rno04090]
 Proteins
  57301 (Ccr1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srw DUF1240 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 57301
NCBI-ProteinID: NP_065417
RGD: 708446
Ensembl: ENSRNOG00000006715
UniProt: Q9JLY8
Position
8
AA seq 355 aa
MEISNITETYPTTTEYDYGDSTPCQKTDVRAFGAGLLPPLYSFVFIIGVVGNILVILVLM
QHRRLQSMTSIYLFNLAVSDLVFLFTLPFWIDYKLKDNWVFGDAMCKLLSGFYYLGLYSE
IFFIILLTIDRYLAIVHAVFSLRARTVTFGIITSIIIWALAILASIPALCFFKAQWEFTH
HTCSPHFPDESLKTWKRFQALKLNLLGLILPLLVMIICYAGIIRILLRRPNEKKAKAVRL
IFAITLLFFLLWTPYNLTVFVSAFQDVLFTNQCEQSKQLDLAIQVTEVIAYTHCCVNPII
YVFVGERFRKYLRQLFQRHVAIPLAKWLPFFSVDQLERTSSLTPSTGEHELSGGF
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggagatttcaaatatcacagaaacctaccccacaaccacagaatatgactatggggac
tctactccatgccaaaaaactgatgtaagagccttcggggctggactcctgccccccctg
tactctttcgtgtttatcattggagtggtaggcaatatcctggtgattctggtgctcatg
cagcataggaggcttcaaagcatgaccagcatatacctgttcaacctggctgtctctgat
ctggtcttccttttcactttacctttctggattgactacaagctgaaagacaactgggtt
tttggtgatgccatgtgtaagcttctctctgggttttattacctgggcttatacagtgag
atcttctttatcatcctgctgacaattgacaggtacctggccattgtccatgcagtgttt
tccctgagggcccgaactgtcacttttggcatcatcaccagtattattatttgggcccta
gccatcttagcttctattcctgccttatgctttttcaaggcccagtgggagttcactcac
catacctgtagccctcatttccccgatgagagcctgaagacgtggaagaggtttcaggct
ctaaagctaaacctccttggactaattttacctctgttagtcatgataatttgctacgca
gggatcatcagaattctgctcagacgacccaatgagaagaaggccaaagccgtgcgtctg
atatttgctattacgcttctattcttcctcctctggaccccctacaatctgactgtattt
gtttctgctttccaagatgttctattcaccaatcagtgtgagcagagcaagcagctggac
ctggccatacaggtgactgaagtgattgcctacacccactgttgtgtcaatccaatcatt
tatgtctttgtgggtgagcggttccggaagtaccttcggcagctgtttcaaaggcatgtg
gctataccgctggcaaaatggctgcccttcttctctgtggaccaactagaaaggaccagt
tccttaactccatccacaggagaacatgaactttctgggggcttctga

DBGET integrated database retrieval system