KEGG   Rattus norvegicus (rat): 117028
Entry
117028            CDS       T01003                                 

Gene name
Bin1
Definition
(RefSeq) bridging integrator 1
  KO
K12562  amphiphysin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    117028 (Bin1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    117028 (Bin1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    117028 (Bin1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    117028 (Bin1)
  Bin/Amphiphysin/Rvs (BAR) family proteins
   N-BAR proteins
    117028 (Bin1)
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    117028 (Bin1)
SSDB
Motif
Pfam: BAR SH3_9 SH3_1 SH3_2 UPF0149 THP2
Other DBs
NCBI-GeneID: 117028
NCBI-ProteinID: NP_446411
RGD: 621786
Ensembl: ENSRNOG00000012852
UniProt: O08839
Structure
PDB: 
1BB9

Position
18p12
AA seq 588 aa
MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTR
LQKDLRTYLASVKAMHEASKKLSECLQEVYEPEWPGRDEANKIAENNDLLWMDYHQKLVD
QALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKPVSLLEK
AAPQWCQGKLQAHLVAQTNLLRNQAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVN
TFQSIAGLEENFHKEMSKLNQNLNDVLVSLEKQHGSNTFTVKAQPSDSAPEKGNKSPSPP
PDGSPAATPEIRVNHEPEPASGASPGATIPKSPSQLRKGPPVPPPPKHTPSKEMKQEQIL
SLFDDAFVPEISVTTPSQFEAPGPFSEQASLLDLDFEPLPPVASPVKAPTPSGQSIPWDL
WEPTESQAGVLPSGEPSSAEGSFAVAWPSQTAEPGPAQPAEASEVVGGTQEPGETAASEA
TSSSLPAVVVETFSATVNGAVEGSTTTGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGD
VVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVQ
NT seq 1767 nt   +upstreamnt  +downstreamnt
atggcagagatggggagcaagggggtgacggcggggaagatcgcaagcaatgttcagaag
aagctgactcgagctcaggagaaggtcctgcagaaactggggaaggcggatgaaacgaag
gatgagcagttcgaacagtgcgtccagaatttcaataagcagctgacagagggcacccgg
ctgcagaaggatcttcggacctacctggcttctgttaaagccatgcacgaagcctccaag
aagctgagtgagtgtctccaggaggtgtatgagcctgagtggcctggcagggatgaagcg
aacaagatagcagagaacaatgacctgctatggatggactatcaccagaagctggtggac
caggctctgctgaccatggatacctacctgggccagttccctgatatcaagtcacgcatt
gccaagcgggggcggaagctggtggactacgacagcgcccggcaccactatgagtctctt
caaaccgccaaaaagaaggatgaagccaaaattgccaagcctgtctcgctgcttgagaaa
gccgccccccagtggtgccaaggcaaactacaggctcatcttgtagctcaaactaacctg
ctccgaaatcaggcagaagaggagctcatcaaagcccagaaggtgttcgaggagatgaat
gtggacctgcaggaggagctgccatccctgtggaacagccgtgtgggtttctatgtcaac
acgttccagagcatcgcgggtctggaggaaaacttccataaagagatgagtaagctcaat
cagaacctcaatgatgtcctggtcagcctagagaagcaacacgggagcaacaccttcaca
gtcaaggcccagcccagtgacagcgcccctgaaaaagggaacaagagcccttcacctcct
ccagatggttcccctgctgctacccctgagatcagagtgaaccatgagccagagccggcc
agtggggcatcgcctggggctaccatccccaagtccccatctcagctccggaaaggccca
ccggtccctccgcctcccaaacacaccccatccaaggagatgaagcaggagcagattctc
agcctttttgatgacgcatttgtccctgagatcagcgtgaccaccccctcccagtttgag
gcccctgggcctttctcagagcaggccagtctactagacctggacttcgagccccttcca
ccagtggcaagccctgtgaaggcacccacaccctctggtcagtcaatcccatgggacctc
tgggagcccacagagagtcaagctggcgtcctgccttccggggagcccagttctgctgag
ggcagctttgctgtggcctggcccagccagacagccgagccagggcctgcccaaccagca
gaggcctccgaggtggtgggtggaacccaggagccaggggagacagcagccagtgaagcg
acctccagctctctcccggctgtggtggtggagaccttctcagcaactgtgaatggcgcc
gtggagggcagcactacgactggacgcttggatctgcccccgggattcatgttcaaggtg
caagcccagcatgattacacggccactgacactgacgagctgcaactcaaagctggcgat
gtggtactggtgatccccttccagaacccagaggagcaggatgaaggctggctcatgggt
gtgaaggagagcgactggaatcagcacaaggaactggagaaatgccgcggcgtcttcccg
gagaatttcacagagcgggtgcagtga

DBGET integrated database retrieval system