KEGG   Rattus norvegicus (rat): 117030Help
Entry
117030            CDS       T01003                                 

Gene name
Erp29
Definition
(RefSeq) endoplasmic reticulum protein 29
  KO
K09586  endoplasmic reticulum protein 29
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    117030 (Erp29)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    117030 (Erp29)
   04131 Membrane trafficking [BR:rno04131]
    117030 (Erp29)
Chaperones and folding catalysts [BR:rno03110]
 Protein folding catalysts
  Protein disulfide isomerase
   117030 (Erp29)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    117030 (Erp29)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERp29_N ERp29
Motif
Other DBs
NCBI-GeneID: 117030
NCBI-ProteinID: NP_446413
RGD: 619781
Ensembl: ENSRNOG00000001348
UniProt: P52555
Structure
PDB: 

Position
12q16
AA seq 260 aa AA seqDB search
MAAAVPGAVSLSPLLSVLLGLLLLSAPHGASGLHTKGALPLDTVTFYKVIPKSKFVLVKF
DTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYL
FRDGDFENPVPYSGAVKVGAIQRWLKGQGVYLGMPGCLPAYDALAGQFIEASSREARQAI
LKQGQDGLSGVKETDKKWASQYLKIMGKILDQGEDFPASELARISKLIENKMSEGKKEEL
QRSLNILTAFRKKGAEKEEL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgccgttcctggcgccgtttcgctctccccactgctgtccgttctccttggc
ctgctgctcctctctgctcctcatggcgccagcggcctgcacacgaagggcgcccttccc
ttggacacagtcactttctacaaggtcattcccaaaagcaagttcgtcttggtgaagttc
gacacccagtacccctatggagagaagcaagatgagtttaagcgtctggctgagaactca
gcctccagcgatgatctcttggtggcagaggtggggatctcagactatggtgacaagctg
aacatggagctgagtgagaagtacaagctggacaaagagagctacccagtcttctacctc
ttccgggatggggactttgagaatcctgtcccatacagcggggcagttaaagttggagcc
atccagcgctggctcaaggggcagggagtctatctgggcatgcctggatgtctgcctgcg
tacgatgccctggcgggccagttcatcgaggcctccagcagagaggcccgccaggccatc
ctgaaacaggggcaggatggcctctcaggtgtgaaggagacagacaagaagtgggccagt
cagtacctgaagatcatggggaagatcttggaccaaggtgaagacttcccggcctccgag
ctggcccggatcagtaagctcattgagaacaagatgagtgagggtaagaaggaagagctg
cagaggagcctcaacatcctcaccgccttccgcaagaaaggcgccgagaaggaggagctg
tga

DBGET integrated database retrieval system