KEGG   Rattus norvegicus (rat): 117033
Entry
117033            CDS       T01003                                 

Gene name
Mmp12, Mme
Definition
(RefSeq) matrix metallopeptidase 12
  KO
K01413  matrix metalloproteinase-12 (macrophage elastase) [EC:3.4.24.65]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    117033 (Mmp12)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.65  macrophage elastase
     117033 (Mmp12)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M10
   117033 (Mmp12)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Reprolysin_3 Metallopep Astacin Peptidase_M66 DUF4953 Peptidase_M54 Reprolysin_5
Other DBs
NCBI-GeneID: 117033
NCBI-ProteinID: NP_446415
RGD: 620195
Ensembl: ENSRNOG00000030187
UniProt: Q63341 R9PXT7
Position
8q11
AA seq 477 aa
MNWTLLLKGAGTMKFLLVLVLLVSLQVSACGAAPMNESEFAEWYLSRFFDYQGDRIPMTK
TKTNRNLLEEKLQEMQQFFGLEVTGQLDTSTLKIMHTSRCGVPDVQHLRAVPQRSRWMKR
YLTYRIYNYTPDMKRADVDYIFQKAFQVWSDVTPLRFRKIHKGEADITILFAFGDHGDFY
DFDGKGGTLAHAFYPGPGIQGDAHFDEAETWTKSFQGTNLFLVAVHELGHSLGLPHSNNP
KSIMYPTYRYLHPNTFRLSADDIHSIQSLYGAPVKNPSLTNPGSPPSTVCHQSLSFDAVT
TVGDKIFFFKDWFFWWRLPGSPATNITSISSMWPTIPSGIQAAYEIGGRNQLFLFKDEKY
WLINNLVPEPHYPRSIHSLGFPASVKKIDAAVFDPLRQKVYFFVDKQYWRYDVRQELMDA
AYPKLISTHFPGIRPKIDAVLYFKRHYYIFQGAYQLEYDPLLHRVTKTLSSTSWFGC
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgaactggactctgttgctgaaaggagctggcacaatgaagtttctcctcgtgctggtg
ctgcttgtgtccttacaggtatctgcctgtggggctgctcccatgaacgagagcgaattt
gctgaatggtacttgtcaagattttttgactatcaaggggacagaattccaatgacaaaa
acaaaaaccaatagaaacctcctagaagaaaaactccaggaaatgcagcagttctttggg
ctagaagtaactgggcaactggacacctcaactctgaaaataatgcacacgtctcgatgt
ggagtgcctgatgtacagcatcttagagcagtgccccagaggtcaagatggatgaagcgg
tatctcacttacaggatctataattacactccagacatgaagcgtgcggatgtagactac
atatttcagaaagcttttcaagtctggagcgatgtcactcctctaagattcagaaagatt
cataaaggcgaggctgacattacgatactttttgcatttggagatcatggagacttctac
gattttgatggcaaaggtggtaccttagcccatgctttttatcctgggcccggtattcaa
ggagatgcacattttgatgaggcagaaacctggactaaaagttttcaaggcacaaacctg
ttccttgttgctgttcatgagcttggccattccttggggctgccgcattccaataatcca
aaatcaataatgtaccctacctacagataccttcaccccaacacatttcgtctctctgct
gatgacatacacagcattcagtccctctacggagccccagtgaaaaacccatccttgaca
aatcctggaagtccaccatcaactgtgtgtcaccaaagcttgagttttgatgctgtcaca
acagtgggagataaaatctttttctttaaagactggttcttctggtggaggctgcctggg
agtccagccaccaacattacttcaatttcttccatgtggccaactatcccatctggtatt
caagctgcttatgaaattggaggcagaaatcaactttttctttttaaagatgagaagtac
tggttaataaacaacttggtaccagagccacactatcccagaagcatacattctctgggc
ttccctgcatctgtaaagaagattgatgcagctgtctttgatccacttcgccaaaaggtc
tatttctttgtggataaacaatattggaggtacgatgtgaggcaggaactcatggacgct
gcttaccccaagctgatttctacacacttcccaggaatcaggccaaaaattgatgcagtt
ctctatttcaaaaggcactactacatcttccaaggagcctaccaattggaatatgacccc
ttactgcatcgtgtcaccaaaacattgagcagtacgagctggttcggttgttag

DBGET integrated database retrieval system