KEGG   Rattus norvegicus (rat): 117035Help
Entry
117035            CDS       T01003                                 

Gene name
Slc25a20
Definition
(RefSeq) solute carrier family 25 member 20
  KO
K15109  solute carrier family 25 (mitochondrial carnitine/acylcarnitine transporter), member 20/29
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    117035 (Slc25a20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    117035 (Slc25a20)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   117035 (Slc25a20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr Polysacc_synt_3
Motif
Other DBs
NCBI-GeneID: 117035
NCBI-ProteinID: NP_446417
RGD: 621443
Ensembl: ENSRNOG00000020288
UniProt: Q66HP8
Position
8q32
AA seq 301 aa AA seqDB search
MAEEPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTIDCFR
KTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKRLQQKSPEDELTYPQLFTAGMLS
GVFTTGIMTPGERIKCLLQIQASSGKNKYSGTLDCAKKLYQEFGIRGFYKGTVLTLMRDV
PASGMYFMTYEWLKNLFTPQGKSVHDLSVPRVLVAGGFAGIFNWVVAIPPDVLKSRFQTA
PPGKYPNGFRDVLRELIREEGVTSLYKGFNAVMIRAFPANAACFLGFEIAMKILNWIAPN
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggagccgaaacccatcagtccgcttaagaacctccttgccggcggctttggc
ggcgtgtgcctggtgtttgtggggcaccccttggacacggtcaaggtccgactgcagaca
caaccaccaagtttgcctgggcagccacctatgtactctgggaccatcgactgtttccgg
aagactctttttagagagggcatcacagggctgtatcggggcatggctgcacccatcatt
ggagtcacccctatgtttgccgtgtgcttctttgggtttggtttggggaagagactacag
cagaaatctccagaggatgaacttacctacccgcagctgtttacagctgggatgttatct
ggtgtgttcaccacaggaatcatgacccctggagaacggatcaaatgcttactgcagatt
caggcttcttcagggaaaaacaaatacagtggtaccttggactgtgcaaagaagctgtat
caggagtttgggatccgtggcttctacaaagggactgtgctcactctcatgcgagatgtt
cctgccagtgggatgtatttcatgacatacgaatggcttaaaaatctcttcactccacag
ggaaagagtgtccatgacctcagtgtgcctcgggtcctggtggctggcggctttgcaggg
atcttcaattgggttgtggcaatccccccagacgtgctcaagtctcgattccagaccgca
cctcctggaaaatatcctaatggtttcagagatgtgttgagagagctgatccgagaagaa
ggagtcacctccttgtacaaagggttcaatgcagtcatgatccgagccttcccagccaat
gctgcctgtttccttggctttgaaattgccatgaagatcctcaattggattgcccccaac
ttgtga

DBGET integrated database retrieval system