KEGG   Rattus norvegicus (rat): 117036
Entry
117036            CDS       T01003                                 

Gene name
Lamc1
Definition
(RefSeq) laminin subunit gamma-1 precursor
  KO
K05635  laminin, gamma 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno05020  Prion disease
rno05145  Toxoplasmosis
rno05146  Amoebiasis
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    117036 (Lamc1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    117036 (Lamc1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    117036 (Lamc1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    117036 (Lamc1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    117036 (Lamc1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    117036 (Lamc1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    117036 (Lamc1)
   05145 Toxoplasmosis
    117036 (Lamc1)
  09164 Neurodegenerative disease
   05020 Prion disease
    117036 (Lamc1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Other DBs
NCBI-GeneID: 117036
NCBI-ProteinID: NP_446418
RGD: 621052
Ensembl: ENSRNOG00000002680
Vega: OTTRNOG00000002096
UniProt: F1MAA7
Position
13
AA seq 1607 aa
MTGGRRAALALQLQRRLWLLLAVLAAVACWVRAAMDECADEGGRPQRCMPEFVNAAFNVT
VVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQLHLQHGAAFLTDYNNQADTTWWQSQT
MLAGVQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSC
ENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQE
WVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFGK
LVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESANQCLPCDCNGRSQECYFDPELYRSTG
HGGHCTNCRDNTDGAKCERCRENFFRLGNTEACSPCHCSPVGSLSTQCDSYGRCSCKPGV
MGDKCDRCQPGFHSLTEAGCRPCSCDPSGSTDECNVETGRCVCKDNVEGFSCERCKPGFF
NLESSNPKGCTPCFCFGHSSVCTNAVGYSVYDISSTFQIDEDGWRVEQRDGSEASLEWSS
DRQDIAVISDTYFPRYFVAPAKFLGNQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGAGL
RVSVPLIAQGNSYPSETTVKYIFRLHEATDYPWRPALSPFEFQKLLNNLTSIKIRGTYSE
RSAGYLDDVTLQSARPGPGVPATWVESCTCPVGYGGQFCETCLPGYRRETPSLGPYSPCV
LCTCNGHSETCDPETGVCDCRDNTAGPHCEKCSDGYYGDSTLGTSSDCQPCPCPGGSSCA
IVPKTKEVVCTHCPTGTAGKRCELCDDGYFGDPLGSNGPVRLCRPCQCNDNIDPNAVGNC
NRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADKCKACACNPYGTVQQQSSCNPVT
GQCQCLPHVSGRDCGACDPGFYNLQSGQGCESCDCHALGSTNGQCDIRTGQCECQPGITG
QHCERCETNHFGFGPEGCKPCDCHHEGSLSLQCKDDGRCECREGFVGNRCDQCEENYFYN
RSWPGCQECPACYRLVKDKVAEHRVKLQELESLIANLGTGDETVTDQAFEDRLKEAEREV
TDLLREAQEVKDVDQNLMDRLQRVNNSLHSQISRLHNIRNTIEETGILAERARSRVESTE
QLIEIASRELEKAKMAAANVSITQPESTGEPNNMTLLAEEARRLAERHKQEADDIVRVAK
TANETSAEAYNLLLRTLAGENQTALEIEELNRKYEQAKNISQDLEKQAARVHEEAKRAGD
KAVEIYASVAQLTPVDSEALESEANKIKKEAADLDRLIDQKLKDYEDLREDMRGKEHEVK
NLLEKGKAEQQTADQLLARADAAKALAEEAAKKGRNTLQEANDILNNLKDFDRRVNDNKT
AAEEALRRIPAINRTIAEANEKTREAQLALGNAAADATEAKNKAHEAERIASGVQKNATS
TKADAERTFSEVTDLDNEVNGMLRQLEEAENELKRKQDDADQDMMMAGMASQAAQEAELN
ARKAKNSVSSLLSQLTDLLEQLGQLDTVDLNKLNEIEGSLNKAKDEMKVSDLDRKVSNLE
NEARKQEAAILDYDRDIAEIIKDIHNLEDIKKTLPTGCFNTPSIEKP
NT seq 4824 nt   +upstreamnt  +downstreamnt
atgacgggcggcaggcgggccgctctggccctgcagctccagcggcggctgtggctgctg
ctggctgtgctggcggccgtggcgtgctgggtccgggcggccatggacgagtgcgcggat
gagggcggccggccgcagcgctgcatgccggagtttgttaatgccgccttcaatgtgacc
gtggtggctaccaacacgtgtgggactccacccgaggagtactgcgtgcagactggagtg
accggagtcaccaagtcctgtcacctgtgcgacgccggccagctccacctgcaacacggg
gcagccttcttgaccgactacaacaaccaggccgacaccacctggtggcaaagccagact
atgctggccggggtgcagtaccccaactccatcaacctcacgctgcacctgggaaaggct
tttgacatcacttacgtgcgtctcaagttccacaccagccgcccagagagtttcgccatt
tataagcgcactcgggaagacgggccctggattccttaccagtactacagtggctcctgt
gagaacacgtactcaaaggctaaccgtggcttcatcaggacgggaggagatgagcagcag
gccttgtgtaccgatgagttcagtgacatttcccccctcaccggcggcaacgtggccttt
tcaactctggaaggaaggccgagtgcctacaactttgacaacagccccgtgctacaggaa
tgggtgacagccactgacatcagagtcacactcaatcgcctgaacacctttggagatgaa
gtattcaatgaccccaaagtcctcaagtcttactattatgcaatctcggactttgctgtg
ggtggcaggtgtaaatgtaatggacatgccagtgagtgtgtaaagaacgagtttgggaag
ctcgtgtgcaactgcaagcataacacatacggagttgactgtgaaaagtgcctgcctttc
ttcaacgatcggccgtggaggagagcaactgccgagagtgccaaccagtgcctgccttgc
gactgcaatggccgatcccaagaatgctactttgaccctgagctataccgttccactggg
cacggtggccactgtaccaactgccgggataacacagacggtgccaagtgcgagaggtgc
cgggagaacttcttccgcctggggaacactgaagcctgctctccgtgccactgcagcccc
gttggttctctcagcacgcagtgtgacagttacggcaggtgcagctgtaagcccggagtg
atgggtgacaagtgtgaccgttgccagcctgggttccattccctcaccgaggcaggatgc
aggccatgctcctgcgacccttctggcagcaccgacgaatgtaatgttgaaacaggaaga
tgcgtttgcaaagacaacgtcgaaggcttcagctgtgagagatgcaaacctggatttttt
aatctggaatcctccaatcctaagggttgcacaccctgcttctgctttgggcattcttct
gtgtgcaccaatgctgttggctacagtgtttatgacatctcctcgacctttcagattgat
gaggacgggtggcgtgtggagcagagagatggctcggaggcgtctcttgagtggtcctca
gaccggcaggatattgctgtgatctcagacacttacttccccagatactttgtcgcccct
gccaagttcctgggcaaccaggtcctgagttacgggcagaacctctcattctccttccga
gtggacagacgggacactcgcctctccgcagaggatctcgtgctggaaggagctggcttg
agagtatccgtgcccttgatcgctcagggcaactcgtaccctagcgagaccactgtgaag
tacatcttcagactccatgaagcaacagattacccttggaggcctgctctctccccattt
gaatttcagaagctcctaaacaacttgacctctatcaagatccgtggtacatacagtgag
aggagcgctggatatttggatgatgtcaccttgcaaagtgctcgccctgggcccggagtc
cccgcaacgtgggtggagtcctgcacctgtccagtggggtatggagggcagttctgtgag
acatgcctcccaggctacagaagagaaaccccaagtcttggaccttacagcccgtgtgtg
ctctgtacctgtaatgggcacagtgagacctgtgaccccgagacaggtgtctgtgactgc
agagacaatactgccggcccgcactgtgagaaatgtagcgatgggtactatggagactca
accctgggcacctcctctgactgccagccttgtccctgccctggcggctcaagttgtgcc
attgtcccaaagacaaaggaagtggtgtgcacacactgtccaactggcactgccggcaag
agatgtgagctctgtgatgacggctactttggagaccctctgggcagcaatggacccgtg
agactctgccgcccatgtcagtgcaacgacaacatagaccccaacgcagttggcaactgc
aaccgtctgactggagaatgcctgaagtgcatctataacacggctggcttctactgcgac
cggtgcaaagaagggtttttcggaaatcccctggctcccaatccagcagacaagtgcaaa
gcctgcgcctgcaatccctatggtacagtacagcagcagagcagctgtaacccagtgacc
gggcagtgccagtgtctgcctcatgtgtcaggccgggactgtggcgcttgtgaccctggc
ttctacaacctgcagagcgggcaaggctgcgagagttgtgactgccatgctttgggctcc
accaacgggcaatgtgacatccgcaccgggcagtgtgagtgtcagcccggcatcaccggt
cagcactgtgagcgctgtgagaccaaccactttgggtttggacctgaaggctgcaaacct
tgcgactgtcaccacgaaggatccctttcgctccaatgtaaggatgacggccgttgtgaa
tgcagggaaggcttcgtgggcaatcgctgtgaccagtgtgaagagaactatttctacaat
cggtcttggcctggctgccaagagtgtccggcttgttaccggctggtgaaggataaggtt
gctgagcatcgagtgaaactccaggagttggagagcctcatagcaaacctcgggactggg
gatgagacggtgacagatcaagcctttgaggacagactgaaggaagcagagagggaggtt
acagacctcctccgtgaggctcaggaagtcaaagatgtagaccaaaatctgatggatcgc
cttcagagagtaaataacagtctgcacagccaaatcagccggctgcacaatatccggaac
actatagaagagacggggatcttggctgagcgagcgcggtcccgagtggagagcacagag
cagctgattgagatcgcctccagggagctcgagaaagcaaaaatggctgccgccaatgtg
tcaatcactcagccagagtctacaggggaaccaaacaacatgaccctcttggcagaagaa
gcccgaaggcttgcagagcgtcataaacaggaagctgatgacattgtacgagtggcaaag
acagccaacgagacctcagctgaggcatataatctgcttttgaggaccctggcaggagaa
aatcaaactgcattggagattgaagagcttaacaggaagtatgaacaagcaaagaacatc
tctcaggacctggagaagcaggctgccagagtccatgaggaagccaagcgagcaggtgac
aaagccgtggagatctatgccagtgtggcccagctgacccctgtggactcggaggctcta
gagagtgaagcaaataaaatcaagaaagaagctgcagatctggaccgtctgattgaccag
aagctaaaagattacgaggaccttagggaagacatgcgaggaaaggaacatgaagtaaag
aaccttctagagaaggggaaagccgaacagcagaccgctgaccaactcctagctcgagcc
gacgctgccaaggctcttgctgaagaagctgctaaaaagggacgcaataccttacaagaa
gctaacgacattctcaacaacctgaaagattttgatagacgagtgaacgataacaagaca
gctgctgaagaagctctaaggagaattcccgccatcaaccggaccatagctgaagccaat
gagaagacaagggaggcacagctggcgctgggcaatgcagcagctgacgccacggaggcc
aagaacaaagcccacgaggcggagaggattgccagtggcgtgcagaagaatgccaccagt
accaaggcggatgcggagagaaccttctcggaagtgacagacctggataacgaggtgaat
ggcatgttgaggcagctagaggaagcggagaatgagctgaagaggaagcaagatgatgcc
gaccaggacatgatgatggcgggaatggcttcacaggctgctcaggaagctgaacttaat
gccagaaaagccaaaaactctgtcagcagcctcctcagccaactgaccgacctcttggag
cagctgggacagctggacaccgtggacctgaacaagctcaacgagatcgaaggctctctg
aacaaagccaaagacgaaatgaaggtgagcgacctggacaggaaggtgtccaacctggag
aacgaggcccggaagcaggaggcagccatcttggactatgaccgagacatagcagagatc
ataaaggacattcacaacctggaggacatcaagaagacactaccaacaggctgctttaac
accccgtccatcgagaaaccctag

DBGET integrated database retrieval system