KEGG   Rattus norvegicus (rat): 117037Help
Entry
117037            CDS       T01003                                 

Gene name
Spam1, Spam
Definition
(RefSeq) sperm adhesion molecule 1
  KO
K01197  hyaluronoglucosaminidase [EC:3.2.1.35]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00531  Glycosaminoglycan degradation
rno01100  Metabolic pathways
Module
rno_M00076  Dermatan sulfate degradation
rno_M00077  Chondroitin sulfate degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    117037 (Spam1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:rno02042]
    117037 (Spam1)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    117037 (Spam1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    117037 (Spam1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.35  hyaluronoglucosaminidase
     117037 (Spam1)
Bacterial toxins [BR:rno02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   117037 (Spam1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate/Haparin
  Enzymes
   117037 (Spam1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Enzymes
  117037 (Spam1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_56
Motif
Other DBs
NCBI-GeneID: 117037
NCBI-ProteinID: NP_446419
RGD: 620547
Ensembl: ENSRNOG00000007231
UniProt: Q62803
Position
4q22
AA seq 512 aa AA seqDB search
MGELQFKWLFWRSFAESGGTFQTVLIFLFIPYSLTVDYRATPVLSDTTFVWVWNVPTEAC
VENVTEPIDLSFFSLIGSPRKTAIGQPVTLFYVDRLGNYPHIDAQQTEHHGGIPQKGDLT
THLVKAKEDVERYIPTDKLGLAIIDWEEWRPTWMRNWTPKDIYRNKSIELVQAADPAINI
TEATVRAKAQFEGAAKEFMEGTLKLGKHIRPKHLWGFYLFPDCYNNKFQVDNYDGQCPDV
EKKRNDDLDWLWKESTGLYPSVYLKKDLKSSRKATLYVRYRVLESIRVSKVSDESNPVPI
FVYIRLVFTDHVSEYLLEDDLVNTIGEIVAQGTSGIIIWDAMSLAQRSAGCPILRQYMKT
TLNPYIVNVTLAAKMCSQTLCKEKGMCSRKTESSDAYLHLDPSSFSINVTEAGKYEVLGK
PEVKDLEYFSEHFKCSCFSKMTCEETSDMRSIQDVNVCMGDNVCIKATLGPNSAFHLLPG
KGLLLMTTLAHILHHLPHDIFVFPWKMLVSTP
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgggagagttgcaatttaagtggctcttttggaggagctttgctgagtctgggggcaca
ttccaaacagtgttaatctttcttttcattccatattccttgactgtggattatagggca
acaccagttctgtcagatacaactttcgtttgggtctggaatgttccaactgaagcttgt
gtagaaaacgttactgaaccaatagatctgagcttcttctctttaattggaagcccccgg
aaaactgccatagggcagcctgtcacattattttatgttgatcgacttggtaactatcct
cacatagatgcacagcaaacagaacatcatggaggaatacctcagaagggggatttgaca
actcatttggtgaaagctaaggaagacgtagagcgttacataccaacagacaaactgggt
ttagctatcattgactgggaagaatggaggcctacctggatgagaaactggacacctaag
gatatttacaggaataagtctattgaattggtccaggcagctgatccagcaattaatatc
acagaagctactgtgagagccaaagcacaatttgaaggggcagctaaagagtttatggaa
gggactttaaaattggggaaacatattcgaccaaagcacttatggggtttttatctattt
cctgattgttataacaataaatttcaagtcgataactatgatggccaatgccctgatgtg
gaaaagaaacgaaacgatgatcttgactggctatggaaagaaagcacgggcctttaccca
tctgtctatttgaagaaagatttgaagtcgagtcgaaaagcaaccctttatgtccgctac
cgagttttagaatctatcagagtgtccaaagtttcagatgaatcgaatccagttccaatt
tttgtctatatccgtcttgttttcactgatcatgtctctgaataccttctagaggatgat
cttgtgaatacaattggtgaaattgttgctcagggtacctctggaattataatatgggat
gctatgtctttagcacaacgttcggcaggttgcccaatcctacgtcaatacatgaagaca
accctgaatccatacatagtcaatgtcaccctagcagccaaaatgtgcagtcaaacactt
tgtaaggagaaaggcatgtgttcgagaaaaacagaaagttcagatgcatatcttcacttg
gatccaagtagtttttctattaatgtaacagaagctggaaagtatgaagttcttggcaag
cccgaggttaaagacttggaatacttttctgaacattttaaatgcagctgttttagcaaa
atgacatgtgaggagacatctgatatgcgaagtatacaagatgtgaatgtgtgcatgggt
gacaatgtttgtataaaagccacgctaggacccaactcagcattccacctcctacctggc
aaaggcctcctccttatgacaacacttgctcacatcttgcaccatctaccacatgatatt
tttgtttttccgtggaagatgctagtcagtactccttag

DBGET integrated database retrieval system