KEGG   Rattus norvegicus (rat): 117037
Entry
117037            CDS       T01003                                 

Gene name
Spam1
Definition
(RefSeq) hyaluronidase PH-20 precursor
  KO
K01197  hyaluronoglucosaminidase [EC:3.2.1.35]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00531  Glycosaminoglycan degradation
rno01100  Metabolic pathways
rno04142  Lysosome
Module
rno_M00076  Dermatan sulfate degradation
rno_M00077  Chondroitin sulfate degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    117037 (Spam1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    117037 (Spam1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:rno02042]
    117037 (Spam1)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    117037 (Spam1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    117037 (Spam1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.35  hyaluronoglucosaminidase
     117037 (Spam1)
Bacterial toxins [BR:rno02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   117037 (Spam1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Enzymes
   117037 (Spam1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Enzymes
  117037 (Spam1)
SSDB
Motif
Pfam: Glyco_hydro_56
Other DBs
NCBI-GeneID: 117037
NCBI-ProteinID: NP_446419
RGD: 620547
Ensembl: ENSRNOG00000007231
UniProt: Q62803
Position
4
AA seq 512 aa
MGELQFKWLFWRSFAESGGTFQTVLIFLFIPYSLTVDYRATPVLSDTTFVWVWNVPTEAC
VENVTEPIDLSFFSLIGSPRKTAIGQPVTLFYVDRLGNYPHIDAQQTEHHGGIPQKGDLT
THLVKAKEDVERYIPTDKLGLAIIDWEEWRPTWMRNWTPKDIYRNKSIELVQAADPAINI
TEATVRAKAQFEGAAKEFMEGTLKLGKHIRPKHLWGFYLFPDCYNNKFQVDNYDGQCPDV
EKKRNDDLDWLWKESTGLYPSVYLKKDLKSSRKATLYVRYRVLESIRVSKVSDESNPVPI
FVYIRLVFTDHVSEYLLEDDLVNTIGEIVAQGTSGIIIWDAMSLAQRSAGCPILRQYMKT
TLNPYIVNVTLAAKMCSQTLCKEKGMCSRKTESSDAYLHLDPSSFSINVTEAGKYEVLGK
PEVKDLEYFSEHFKCSCFSKMTCEETSDMRSIQDVNVCMGDNVCIKATLGPNSAFHLLPG
KGLLLMTTLAHILHHLPHDIFVFPWKMLVSTP
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgggagagttgcaatttaagtggctcttttggaggagctttgctgagtctgggggcaca
ttccaaacagtgttaatctttcttttcattccatattccttgactgtggattatagggca
acaccagttctgtcagatacaactttcgtttgggtctggaatgttccaactgaagcttgt
gtagaaaacgttactgaaccaatagatctgagcttcttctctttaattggaagcccccgg
aaaactgccatagggcagcctgtcacattattttatgttgatcgacttggtaactatcct
cacatagatgcacagcaaacagaacatcatggaggaatacctcagaagggggatttgaca
actcatttggtgaaagctaaggaagacgtagagcgttacataccaacagacaaactgggt
ttagctatcattgactgggaagaatggaggcctacctggatgagaaactggacacctaag
gatatttacaggaataagtctattgaattggtccaggcagctgatccagcaattaatatc
acagaagctactgtgagagccaaagcacaatttgaaggggcagctaaagagtttatggaa
gggactttaaaattggggaaacatattcgaccaaagcacttatggggtttttatctattt
cctgattgttataacaataaatttcaagtcgataactatgatggccaatgccctgatgtg
gaaaagaaacgaaacgatgatcttgactggctatggaaagaaagcacgggcctttaccca
tctgtctatttgaagaaagatttgaagtcgagtcgaaaagcaaccctttatgtccgctac
cgagttttagaatctatcagagtgtccaaagtttcagatgaatcgaatccagttccaatt
tttgtctatatccgtcttgttttcactgatcatgtctctgaataccttctagaggatgat
cttgtgaatacaattggtgaaattgttgctcagggtacctctggaattataatatgggat
gctatgtctttagcacaacgttcggcaggttgcccaatcctacgtcaatacatgaagaca
accctgaatccatacatagtcaatgtcaccctagcagccaaaatgtgcagtcaaacactt
tgtaaggagaaaggcatgtgttcgagaaaaacagaaagttcagatgcatatcttcacttg
gatccaagtagtttttctattaatgtaacagaagctggaaagtatgaagttcttggcaag
cccgaggttaaagacttggaatacttttctgaacattttaaatgcagctgttttagcaaa
atgacatgtgaggagacatctgatatgcgaagtatacaagatgtgaatgtgtgcatgggt
gacaatgtttgtataaaagccacgctaggacccaactcagcattccacctcctacctggc
aaaggcctcctccttatgacaacacttgctcacatcttgcaccatctaccacatgatatt
tttgtttttccgtggaagatgctagtcagtactccttag

KEGG   Rattus norvegicus (rat): 300993
Entry
300993            CDS       T01003                                 

Gene name
Hyal3
Definition
(RefSeq) hyaluronidase-3 precursor
  KO
K01197  hyaluronoglucosaminidase [EC:3.2.1.35]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00531  Glycosaminoglycan degradation
rno01100  Metabolic pathways
rno04142  Lysosome
Module
rno_M00076  Dermatan sulfate degradation
rno_M00077  Chondroitin sulfate degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    300993 (Hyal3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    300993 (Hyal3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:rno02042]
    300993 (Hyal3)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    300993 (Hyal3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    300993 (Hyal3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.35  hyaluronoglucosaminidase
     300993 (Hyal3)
Bacterial toxins [BR:rno02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   300993 (Hyal3)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Enzymes
   300993 (Hyal3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Enzymes
  300993 (Hyal3)
SSDB
Motif
Pfam: Glyco_hydro_56 EGF_2 EGF
Other DBs
NCBI-GeneID: 300993
NCBI-ProteinID: NP_997482
RGD: 1303334
Ensembl: ENSRNOG00000016093
UniProt: Q76HM9 A0A0G2JSP4
Position
8
AA seq 412 aa
MITQLGLTLVVGLTLCLVHVQALLQVPELPFSVLWNVPSARCKTRFGVHLPLDALGIIAN
HGQRFHGQNITIFYKNQFGLYPYFGPRGTAHNGGIPQAVSLDHHLAQAAHQILHNLGSSF
AGLAVLDWEEWYPLWAGNWGTHRQVYQAASWAWAQQMFPDLNPQEQLHKAQTGFEQAARA
LMEHTLRLGQMLRPHGLWGFYRYPVCGNGWHNMASNYTGHCHPAIITRNTQLRWLWAASS
ALFPSIYLPPRLPPAYHQTFVRHRLEEAFRVALTGHAHPLPVLAYVRLTHRSSGRFLSLD
DLMQTIGVSAALGAAGVVLWGDLSVSSSEEECWRLHDYLVGTLGPYVINVTKAATACSHQ
RCHGHGRCSWKDPGQMEAFLHLQPDDNLGAWKSFRCRCYLGWSGPTCLEPKP
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgatcacgcagctaggcctaaccctggtggtggggttaaccctatgcttggtacacgtc
caggctttgctgcaggttcctgagcttcccttttctgtgctgtggaatgtaccctcagca
agatgtaagacccgctttggtgtgcatctgcctctcgatgctcttggcatcatagccaac
catggccagcgttttcatggccaaaacatcaccatcttctataagaaccagttcggtctt
tatccttactttggacctagaggcacagcccacaatgggggaatccctcaggctgtgtcc
ctagaccaccacttggcacaagctgcccaccagatcctccacaacctaggatctagcttt
gctggcttggcagtgctggactgggaagaatggtacccactctgggctgggaactggggc
acccatcgacaagtctaccaggcagcctcctgggcttgggcacagcagatgttccctgac
ttgaaccctcaggaacagctccacaaagcccaaactggctttgagcaggctgcccgtgca
ctgatggaacacacactgcggctgggccagatgcttcgcccacatgggctctggggcttt
tatcgatacccagtctgtggcaatggctggcataatatggcttccaactacacaggccac
tgccatccagccatcattacccgaaacacccagctgcgttggctctgggctgcctccagt
gctctcttccctagcatctacctcccacccagacttccacctgcctaccatcagaccttt
gtacgacaccgcctggaggaggccttccgtgtagccctcactgggcatgcccatccccta
cctgttctggcttatgttcgcctcacacaccggagctctgggagattcttgtctctggat
gacctaatgcagactattggtgtgagtgcagcactgggagcagctggcgtagtgctctgg
ggggacctgagtgtttctagctctgaggaagagtgctggcgtctccatgactacctagtg
ggcactttaggcccctatgtgatcaacgtgaccaaggctgccacagcctgcagtcaccag
cgatgccatggccacggtcgctgttcctggaaagacccaggacaaatggaagcctttcta
catctgcagccagatgacaatcttggagcttggaagtccttcagatgccgttgttacttg
ggctggtctggccctacctgcctggagcctaaaccctga

KEGG   Rattus norvegicus (rat): 367166
Entry
367166            CDS       T01003                                 

Gene name
Hyal1
Definition
(RefSeq) hyaluronidase-1 precursor
  KO
K01197  hyaluronoglucosaminidase [EC:3.2.1.35]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00531  Glycosaminoglycan degradation
rno01100  Metabolic pathways
rno04142  Lysosome
Module
rno_M00076  Dermatan sulfate degradation
rno_M00077  Chondroitin sulfate degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    367166 (Hyal1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    367166 (Hyal1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:rno02042]
    367166 (Hyal1)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    367166 (Hyal1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    367166 (Hyal1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.35  hyaluronoglucosaminidase
     367166 (Hyal1)
Bacterial toxins [BR:rno02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   367166 (Hyal1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Enzymes
   367166 (Hyal1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Enzymes
  367166 (Hyal1)
SSDB
Motif
Pfam: Glyco_hydro_56
Other DBs
NCBI-GeneID: 367166
NCBI-ProteinID: NP_997499
RGD: 1303060
Ensembl: ENSRNOG00000015858
UniProt: Q76HN1
Position
8
AA seq 449 aa
MKPFSPEVSPDPCPATAAHLLRTYTLFLTLLELAQGCRGSMVSNRPFITVWNADTHWCLK
DHGVDVDVSVFDVVANKEQNFQGPNMTIFYREELGTYPYYTPTGEPVFGGLPQNASLVTH
LAHAFQDIKAAMPEPDFSGLAVIDWEAWRPRWAFNWDSKDIYQQRSMELVRAEHPDWPET
LVEAEAQGQFQEAAEAWMAGTLQLGQVLRPRGLWGYYGFPDCYNYDFLSPNYTGQCSLSI
HDQNDQLGWLWNQSYALYPSIYLPAALMGTGKSQMYVRYRVQEAFRLALVSRDPHVPIMP
YVQIFYEKTDYLLPLEELEHSLGESAAQGAAGAVLWISSEKTSTKESCQAIKAYMDSTLG
PFILNVTSAALLCSEALCSGRGRCVRHPSYPEALLTLSPASFSIEPTHDGRPLSLKGTLS
LKDRAQMAMKFKCRCYRGWSGEWCKKQDM
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgaagcccttcagtcctgaggtttccccagacccatgccctgccactgcagcccacctg
cttcgcacctacacgctcttcctgaccttgctggagttggcccaaggttgcagaggttcc
atggtatccaaccggccgttcatcactgtttggaatgcagacactcactggtgcctgaag
gaccacggagtggatgtggatgtcagtgtcttcgacgtggttgccaacaaggagcagaat
ttccaaggccccaacatgactattttctaccgagaggagttgggcacctacccctactat
acacccaccggggaacccgtatttggtggtctgccccagaatgccagcctggttacccac
cttgctcacgcattccaggacatcaaggctgccatgcctgaacctgacttctcgggactg
gcggtcattgattgggaggcttggcgcccacgatgggccttcaactgggacagcaaggac
atttatcagcagcgctcaatggaactggtccgggcagagcaccctgattggccagaaact
ttagtggaagcagaagcccaaggccagttccaggaagctgcagaggcctggatggcaggg
accctccaactggggcaggtactgcgtccccgtggcctctggggctactatggcttccct
gactgctacaactacgactttctaagtcccaactacacaggccagtgctcactgagcatc
catgatcagaatgaccagctagggtggttgtggaaccagagctatgccctttaccccagt
atttacttgcctgcagcactgatgggcacagggaagtcacagatgtatgttcgataccgt
gtgcaagaggcgttccgtttggctttagtttccagagaccctcatgtgcccataatgccc
tacgtccaaatcttctatgaaaagacagattatcttctacccctggaggagctggagcac
agcctgggagagagtgcagcccagggagcggcaggagcagtgctctggataagctcagaa
aaaacaagtaccaaggagtcatgccaagccattaaagcatacatggattccacactcgga
ccctttatcctgaacgtaaccagtgcagctcttttgtgcagcgaagctctgtgttctggc
cgtggtcgttgtgtccgccatcccagttaccctgaggctctcctcaccctcagccctgcc
agcttctccattgagccaacacatgatggcagacccctgagcctcaagggtaccctctcg
cttaaggatcgggcacagatggctatgaaattcaagtgtcgatgctaccgtggatggagt
ggagagtggtgtaagaagcaggatatgtag

KEGG   Rattus norvegicus (rat): 404783
Entry
404783            CDS       T01003                                 

Gene name
Hyal4
Definition
(RefSeq) hyaluronidase-4
  KO
K01197  hyaluronoglucosaminidase [EC:3.2.1.35]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00531  Glycosaminoglycan degradation
rno01100  Metabolic pathways
rno04142  Lysosome
Module
rno_M00076  Dermatan sulfate degradation
rno_M00077  Chondroitin sulfate degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    404783 (Hyal4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    404783 (Hyal4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:rno02042]
    404783 (Hyal4)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    404783 (Hyal4)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    404783 (Hyal4)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.35  hyaluronoglucosaminidase
     404783 (Hyal4)
Bacterial toxins [BR:rno02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   404783 (Hyal4)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Enzymes
   404783 (Hyal4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Enzymes
  404783 (Hyal4)
SSDB
Motif
Pfam: Glyco_hydro_56
Other DBs
NCBI-GeneID: 404783
NCBI-ProteinID: NP_001094250
RGD: 1303194
Ensembl: ENSRNOG00000007212
UniProt: G3V6V8
Position
4
AA seq 481 aa
MQLLSEGQLRRCVVQPVHLTSGLLIFFILKSISSLKPARLPVYQRKPFIAAWNAPTDLCL
IKYNLAVNLKVFQMVGSPRLKDRRQNVVIFYANKLGSYPWYTSEGVPINGGLPQNTSLQV
HLEKAYQDINYYIPSENFSGLAVIDWEYWRPQWARNWNTKDIYRQKSRTLISDMKENIST
ADIEYLAKATFEKSAKAFMEETIKLGIKSRPKGFWGYYLYPDCHNYNFYATNYTGSCPEE
EVLRNNDLSWLWNSSTALYPAVSIRKSFADSENTLHFSQFRVRESLRISTMTSHDYALPV
FVYTRLGYKEEPLLFLSKQDLISTIGESAALGAAGIVVWGDMNLTSSAENCTKVNRFVNS
DFGSYVINVTTAAEVCSRHLCKNNGRCARKTWKAAHYLHLNPASYHIEASADREFVVKGR
ASDADLAAMAENFLCHCYEGYEGADCRDMTEASGPSGVSVSSSSVITLCLIALAGHQSIQ
L
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgcaactattgtctgaaggacaattaagacgctgtgttgttcaaccagtacatcttaca
tcagggctgctcatattttttatcctgaagtctatctcatccctaaaacctgctcgactt
ccagtttatcaaaggaaaccttttatagctgcttggaatgctccaacagacctgtgtttg
ataaaatataatttggcagtgaacttaaaagtgtttcagatggttggaagccctcggctc
aaagacaggaggcaaaatgttgttatattttatgccaacaaattgggatcttacccatgg
tatacatcagaaggggtacccatcaatggtggtcttccccaaaacacaagcttacaggta
cacctggaaaaggcttaccaggatattaattattacatcccttctgaaaatttcagtgga
cttgctgttatagactgggaatattggcgcccacagtgggcccggaactggaacaccaag
gatatctacagacagaagtcaagaactcttatttctgatatgaaggagaacatatccact
gctgatattgaatatttagccaaagcaacttttgagaaaagtgcaaaagctttcatggag
gaaactatcaaattgggaattaagagcagacccaagggcttttggggttattacttgtat
cctgactgccacaattacaatttttatgctacaaactataccgggtcatgcccagaagag
gaagttttgaggaacaatgacctctcttggctctggaacagcagtactgctctgtatcct
gctgttagtattaggaaatcctttgcagacagtgaaaatactttgcacttctcacaattt
cgggtgcgtgaatcactgaggatctctactatgacatcacatgattatgctctgcccgta
tttgtctacacacggctgggctacaaagaggaacctttgcttttcctttctaagcaagat
ctaattagtaccataggagaaagtgctgcgttgggagctgcaggcattgttgtttgggga
gacatgaatttaacttcatctgcggagaactgtacaaaggtgaaccgctttgtgaactct
gattttggtagctacgtaatcaatgtgaccacagcagctgaagtgtgcagtcgtcatctt
tgcaagaacaatgggaggtgtgcacggaagacatggaaagcagctcattacctccacttg
aaccctgcgagttaccacatagaggcctctgcagatagagaattcgtagtgaagggaaga
gcgtcagatgctgacctagccgccatggcagagaattttctatgtcactgttatgagggc
tatgagggggctgactgtagagatatgacagaggccagtggcccctcgggggtttccgtt
tcctctagttcagtaataacactgtgtctgatagctctagcaggtcatcaaagcattcag
ctgtga

KEGG   Rattus norvegicus (rat): 500051
Entry
500051            CDS       T01003                                 

Gene name
Hyal6
Definition
(RefSeq) hyaluronoglucosaminidase 6 precursor
  KO
K01197  hyaluronoglucosaminidase [EC:3.2.1.35]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00531  Glycosaminoglycan degradation
rno01100  Metabolic pathways
rno04142  Lysosome
Module
rno_M00076  Dermatan sulfate degradation
rno_M00077  Chondroitin sulfate degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    500051 (Hyal6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    500051 (Hyal6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:rno02042]
    500051 (Hyal6)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    500051 (Hyal6)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    500051 (Hyal6)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.35  hyaluronoglucosaminidase
     500051 (Hyal6)
Bacterial toxins [BR:rno02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   500051 (Hyal6)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Enzymes
   500051 (Hyal6)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Enzymes
  500051 (Hyal6)
SSDB
Motif
Pfam: Glyco_hydro_56
Other DBs
NCBI-GeneID: 500051
NCBI-ProteinID: NP_001019491
RGD: 1564219
Ensembl: ENSRNOG00000021695
UniProt: Q66H49
Position
4
AA seq 481 aa
MCSQWVAQLGELVLLVLVTQAALKPAMPPVIKNQPFNIFWAAPTLFCKDNFDVNMNLQAF
NIIPNPFETQSGSTIAVFYPKELGYYPYFSEDGISFYGGIPQNVNLSEHLRKSANDIANA
VSLWRSEGLAVIDWEGWRPQWDRNWGGRIIYKNHSLAFTRHHHPDWAETKVRTVAQQEFE
NAGKSLMNVTLTLALEMRPKRLWGFYLYPDCYNYDYRINPEFYTGSCPDDEIFRNDQLMW
LWEKSAALYPSIYLSKILKSDINALKFVHFRVREALRIAEKARKDYALPVFIFSRPFYLQ
SIEALSEEDLVHTIGESAALGAAGIILWGGYEYSDTKETCLSLQQTVHGLLGPYALNVTS
AAKLCSQSLCNSHGRCIRKTPDSSFYLHMPEDSQKNSVTSKGVNFVISPKSKLKAIVNMK
NGFVCHCYYGWHGESCRSHSPNLQKNKVPATGFNLAVSVGMALFVILMNFFLFPTTMVIF
L
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgtgtagccagtgggtggcgcagcttggtgaactggtgctcttggttctggtgactcaa
gccgctctcaaaccagcaatgcctcccgtgatcaagaaccaacctttcaacattttctgg
gctgcccctactttgttttgtaaagataacttcgatgtaaatatgaatcttcaagcgttc
aacatcattcccaatccctttgaaacccagagtggatccactattgctgtattttatcca
aaggaactgggatattatccttatttctctgaagatggaatatccttctacggtggaata
cctcagaatgtgaacctctctgagcacctcaggaaaagcgccaatgacattgcgaatgct
gtctctttgtggcgatcagaaggacttgctgttattgactgggaaggctggaggccccag
tgggataggaattggggcggcagaataatatataaaaaccactcgctagccttcactcgc
caccatcatcctgactgggccgaaacgaaagtgagaacagttgctcagcaagaatttgaa
aatgctggaaaaagtttaatgaacgtcactctcacgttggcgttagaaatgagaccaaag
cgtttatggggcttctatctctatccagattgctacaattatgattaccggataaatcca
gagttctacacaggtagctgcccagacgatgaaattttccgcaatgaccagctcatgtgg
ttgtgggaaaagagtgcagcactttatccttccatatatttgagtaaaatattaaaatca
gacataaatgcactgaaatttgttcattttcgagtgagagaagccctgagaattgctgaa
aaggctaggaaggactatgctttgccagtttttattttttccagaccattttatttgcaa
agtattgaagctttgtcagaggaggacttagtgcacacaattggtgaaagtgctgcattg
ggagcagcaggaataatattgtggggaggatatgaatattctgatacaaaggagacttgc
ttatctttgcaacaaactgttcatgggctattgggcccctatgctctcaatgtaacatca
gcagcaaagctctgtagtcaaagtctatgtaacagccatggaagatgtattcggaagacc
cccgactcctccttttatctgcatatgcctgaagatagccaaaagaattctgtcacgagc
aaaggtgtcaattttgtcatttctccaaaaagtaaactgaaggcaatagtgaatatgaag
aatggatttgtgtgtcactgttactatggctggcacggagagtcctgcagatctcactct
ccaaatctccaaaagaacaaggttcctgcaactggatttaatttagcagtttctgttggc
atggccttatttgtgattctgatgaattttttcctattccctactacaatggtaattttt
ctgtaa

KEGG   Rattus norvegicus (rat): 500052
Entry
500052            CDS       T01003                                 

Gene name
Hyal5
Definition
(RefSeq) hyaluronidase PH-20
  KO
K01197  hyaluronoglucosaminidase [EC:3.2.1.35]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00531  Glycosaminoglycan degradation
rno01100  Metabolic pathways
rno04142  Lysosome
Module
rno_M00076  Dermatan sulfate degradation
rno_M00077  Chondroitin sulfate degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    500052 (Hyal5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    500052 (Hyal5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:rno02042]
    500052 (Hyal5)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    500052 (Hyal5)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    500052 (Hyal5)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.35  hyaluronoglucosaminidase
     500052 (Hyal5)
Bacterial toxins [BR:rno02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   500052 (Hyal5)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Enzymes
   500052 (Hyal5)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Enzymes
  500052 (Hyal5)
SSDB
Motif
Pfam: Glyco_hydro_56
Other DBs
NCBI-GeneID: 500052
NCBI-ProteinID: NP_001019492
RGD: 1566275
Ensembl: ENSRNOG00000039466
UniProt: Q5BK36
Position
4
AA seq 526 aa
MRVLCFKHSFFGSLLESSGLPQTLLVFLLIRCCLTVDFRAPPLIPNVPFLCAWNAPTESC
ATRFNQPLDLSLFSLVGSPRKTAIGHPVTIFYSDRLGLYPHIDEMHTAFHGGIPQLGSLK
SHLEIAKGDIHHYMPIDNVGLAVIDWEDWRPTWSRNWKFKDIYRNKSIEFVQQQNTQLNL
TEAVKRAKQEFEEAARNFMEQTLKLGKLLRPNHLWGFYLFPDCYNNNFQDANYKGDCPDI
EKQRNDALFWIWKESTALYPSIYLKSSLKSSPLAALYVRNRVQEAIRMSKVKDPHNPLPI
FVYFRPVFTDLTFQYLEQDDLVNTIGETVALGASGIVMWGTLNLSQTMKSCMNLHDYLKT
TLNPYIINVTLAAKMCSQTLCQNQGICSRKDWNSNDYLHLSPRNFQIHFIKHGKYEIIGS
PTLDDLQYFSKNFRCSCFSNLDCKERVDINHVSRVNVCTLEDICINSLVISDRSKLHDNW
DHLYFANDKQSGITSSATVSPCVPRKDVSGYLFVLSLYSRHLKYSL
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgcgagtgttgtgttttaaacactccttctttgggagccttcttgagtccagtggacta
ccccagactctattagtcttccttttgattcgatgttgcttgactgtggattttagggca
cccccacttatccctaatgtgcctttcctctgtgcctggaatgccccaactgagtcttgt
gccacgaggtttaatcagccactagatcttagtctgttctctttagtaggaagccccaga
aaaactgccataggtcatcctgtcacaatattttattctgatcgtctgggtctctatcct
cacatagatgaaatgcacacagcttttcatggaggtataccccagctggggtctctaaaa
tctcatttggaaatagctaagggtgacatccatcattacatgccaatagacaatgtgggc
ttggctgtcattgactgggaagactggcggcctacctggtcaagaaactggaaattcaag
gatatttacaggaataagtctattgagttcgtccagcaacaaaacacacaacttaatttg
acagaagctgtcaagagggctaaacaagaatttgaagaggcagcaaggaattttatggaa
cagactttaaaattgggaaaattacttcgtccaaatcacttatggggtttttatcttttt
cctgattgttataacaacaattttcaagatgccaattacaaaggagattgccctgatata
gaaaagcaaaggaatgatgctctcttctggatatggaaggaaagcacagccctgtaccca
tccatctatttgaagagcagcttaaagtcatccccactggcagcactctacgtcagaaat
cgcgtacaagaagccattcgcatgtctaaagtaaaagaccctcataatccacttcctatt
tttgtatatttccgccctgtctttactgacctaactttccagtatctggaacaggatgac
cttgtgaatacaattggtgaaacagttgctctgggtgcctctggaatagtaatgtgggga
actcttaatttatcacaaactatgaaatcttgtatgaacttacatgattatttgaagacc
accctgaatccttatataatcaatgtcacccttgcagccaaaatgtgtagccaaacactt
tgccagaatcaaggcatatgttcgaggaaagattggaattcgaatgactatctacacttg
agccctcggaattttcagattcattttataaaacatggaaagtatgaaatcattggcagt
cccactcttgatgatctgcagtatttttccaaaaacttccgttgcagctgtttctccaac
ttggactgtaaggagagagttgacataaaccatgtgagcagggtcaatgtgtgtactctt
gaagacatttgcattaattcccttgtaatttcagaccgtagtaagctacatgacaactgg
gatcacctttattttgctaatgacaaacagtcaggtattacatcatctgccacagtgagt
ccatgtgtgccaagaaaagatgtcagtgggtacctctttgttctctctctctattcacgg
catttgaaatattcactatag

KEGG   Rattus norvegicus (rat): 64468
Entry
64468             CDS       T01003                                 

Gene name
Hyal2
Definition
(RefSeq) hyaluronidase-2 precursor
  KO
K01197  hyaluronoglucosaminidase [EC:3.2.1.35]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00531  Glycosaminoglycan degradation
rno01100  Metabolic pathways
rno04142  Lysosome
Module
rno_M00076  Dermatan sulfate degradation
rno_M00077  Chondroitin sulfate degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    64468 (Hyal2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    64468 (Hyal2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:rno02042]
    64468 (Hyal2)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    64468 (Hyal2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    64468 (Hyal2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.35  hyaluronoglucosaminidase
     64468 (Hyal2)
Bacterial toxins [BR:rno02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   64468 (Hyal2)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Enzymes
   64468 (Hyal2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Enzymes
  64468 (Hyal2)
SSDB
Motif
Pfam: Glyco_hydro_56
Other DBs
NCBI-GeneID: 64468
NCBI-ProteinID: NP_742037
RGD: 620321
Ensembl: ENSRNOG00000031420
UniProt: Q80ZC7
Position
8
AA seq 473 aa
MRAGLGPIITLALVLEVAWASELKPTAPPIFTGRPFVVAWNVPTQECAPRHKVPLDLRAF
DVEATPNEGFFNQNITTFYYDRLGLYPRFDAAGMSVHGGVPQNGSLCAHLPMLKEAVERY
IQTQEPAGLAVIDWEEWRPVWVRNWQEKDVYRQSSRQLVASRHPDWPSDRIVKQAQYEFE
FAARQFMLNTLRYVKAVRPQHLWGFYLFPDCYNHDYVQNWDSYTGRCPDVEVARNDQLAW
LWAESTALFPSVYLDETLASSKHSRNFVSFRVQEALRVAHTHHANHALPVYVFTRPTYTR
GLTELSQMDLISTIGESAALGSAGVIFWGDSVYASSMENCQNLKKYLTQTLVPYIVNVSW
ATQYCSWTQCHGHGRCVRRNPSASTFLHLSPSSFRLVPGRTPSEPQLRPEGELSEDDLSY
LQMHFRCHCYLGWGGEQCQWNHKRAAGDASRAWAGAHLASLLGLVAMTLTWTL
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgcgggcaggactgggtcccatcatcacactggccctagtgctggaggtagcatgggcc
tcggagcttaagcccacagcgccgcccatcttcaccggccgaccctttgtggtagcatgg
aatgtacccacacaagaatgtgctccgcgccacaaagtgcccctggaccttagggccttc
gatgtggaggctacacctaacgagggttttttcaaccagaatatcaccaccttctactat
gaccgtctaggcctgtatccacgttttgatgcagctgggatgtctgtgcatggtggcgtg
cctcagaacggtagcctctgtgcacacctgcccatgctgaaggaagctgtggaacgctac
attcagacccaggagcctgcggggctggcggtcattgactgggaggaatggcgaccagtg
tgggttcgaaactggcaggagaaagatgtgtaccggcagtcttcacgccagctggtggcc
agtcgacaccctgactggccatcagaccgaatagtgaagcaggcgcagtacgaattcgag
ttcgctgctcggcagttcatgttgaacacactccgttacgtcaaggcagtcagacctcag
cacctgtggggcttctacctctttcctgactgctataatcatgattacgtacagaactgg
gatagctacacaggccgctgtcctgacgtggaggtggcacgaaatgaccagttggcctgg
ctctgggctgagagtacagctctctttccctccgtgtacctggacgagacgctggcatcc
tccaaacacagccgcaactttgtcagcttccgtgttcaggaggcccttcgtgtggctcac
acccaccatgcaaaccatgcactccccgtgtatgtcttcacgcgtcccacatatacccga
gggctcacagaacttagccagatggacctcatctctaccatcggtgagagcgccgccctg
ggctcagctggtgttatcttctggggcgactcagtgtacgcttcaagtatggagaactgc
cagaacctcaagaagtacctaacgcagacgctggtcccctacatagtcaatgtgtcctgg
gccacccagtactgcagttggacccagtgccatggccatgggcgctgtgtgcgccgcaat
cccagcgccagtaccttcttgcacctcagtcccagcagcttccgcctggtgcctggccgc
acgcccagtgaaccccagcttcgacctgagggggagctcagcgaagatgacctcagctac
ctgcagatgcactttcgctgccactgctatctgggctggggtggtgagcagtgccagtgg
aaccataaacgggcagctggggatgccagtagagcctgggctggagcccacctcgccagt
ctcctgggtttggtagctatgactctcacctggaccttataa

DBGET integrated database retrieval system