KEGG   Rattus norvegicus (rat): 117043Help
Entry
117043            CDS       T01003                                 

Gene name
RragB, Ragb
Definition
(RefSeq) Ras-related GTP binding B
  KO
K16185  Ras-related GTP-binding protein A/B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    117043 (RragB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    117043 (RragB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gtr1_RagA Roc Ras Arf MMR_HSR1 ABC_tran PduV-EutP AAA_24 SecA_DEAD DEAD
Motif
Other DBs
NCBI-GeneID: 117043
NCBI-ProteinID: NP_446424
RGD: 619805
Ensembl: ENSRNOG00000003160
UniProt: Q63487
Position
Xq12
AA seq 374 aa AA seqDB search
MEESDSEKKTEKENVGPKVEPPLGEPEGSLGWAMPNAAMKKKVLLMGKSGSGKTSMRSII
FANYIARDTRRLGATILDRIHSLQINSSLSTYSLVDSVGNTKTFDVEHSHVRFLGNLVLN
LWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPE
AKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECSCFRTSIWDETLYKAWSSIVYQ
LIPNVQQLEMNLRNFAEIIEADEVLLFERATFLVISHYQCKEQRDAHRFEKISNIIKQFK
LSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEK
LERVDGPKQCLLMR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggaagaatctgactccgagaaaaagacggagaaagagaatgtgggcccaaaagtggag
cctcctctaggggagccggaaggatcgcttgggtgggcaatgccaaatgcagccatgaag
aaaaaggtgctgttgatgggtaaaagtggatctggtaagaccagcatgaggtctattatc
tttgcaaattatattgccagagacacacgtcgtcttggtgcaacaatactagaccgtata
catagtcttcaaattaatagcagtttgagcacctactctctcgtagactctgttggaaat
acaaagacatttgatgtagaacattctcatgttcgatttctgggaaacctggttttgaac
ctgtgggattgtggtggacaagacaccttcatggaaaattacttcactagccagcgtgac
aacatcttccgaaatgtggaggttctgatttatgtctttgacgtggagagccgtgaactc
gagaaagacatgcactactatcagtcatgccttgaggctattctgcagaattccccagaa
gccaaaatcttttgcttggtacacaaaatggatttggtccaggaggatcagcgagacttg
atttttaaagaacgagaagaagacttaaggcgtttatcgcgtccgttagaatgttcttgt
ttccgaacatctatctgggatgaaactctgtataaggcttggtccagcattgtttatcag
ctgattcccaatgttcagcaactggaaatgaacctgcgcaattttgctgaaattattgag
gctgatgaagtacttctgtttgagagagctacctttctggtgatttctcactatcagtgt
aaagaacagcgagatgcccaccgatttgagaaaatcagcaacattattaagcagttcaag
ctgagctgtagcaagctggctgcctctttccagagtatggaagtcaggaattctaacttt
gctgctttcattgacatattcacatccaacacttacgtcatggtcgtgatgtctgatcca
tccattccttctgcagctactctgatcaacatccgcaatgccagaaaacactttgaaaag
ctggagagagtggatggaccaaaacagtgtcttctcatgcgctaa

DBGET integrated database retrieval system