KEGG   Rattus norvegicus (rat): 117054
Entry
117054            CDS       T01003                                 

Gene name
Cd52, B7
Definition
(RefSeq) CD52 molecule
  KO
K06488  CDW52 antigen
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    117054 (Cd52)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    117054 (Cd52)
CD molecules [BR:rno04090]
 Proteins
  117054 (Cd52)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  117054 (Cd52)
SSDB
Motif
Pfam: CD52
Other DBs
NCBI-GeneID: 117054
NCBI-ProteinID: NP_446435
RGD: 620627
Ensembl: ENSRNOG00000015403
UniProt: Q63064
Position
5q36
AA seq 96 aa
MNTFLLLLTISLLVVVQIQTGDLGQNSTAVTTPANKAATTAAATTKAAATTATKTTTAVR
KTPGKPPKAGASSITDVGACTFLFFANTLMCLFYLS
NT seq 291 nt   +upstreamnt  +downstreamnt
atgaacaccttcctcctcctcctcaccatcagtctcctggttgtggtccagatccaaaca
ggagacttgggacaaaacagtactgctgttactacccctgccaacaaagccgccacgact
gccgccgccaccaccaaggctgccgccaccactgccaccaaaaccaccaccgctgtcaga
aaaacccctgggaaaccccccaaggctggggcctcatccatcaccgatgtgggggcctgc
acttttcttttctttgccaacaccttaatgtgcctcttctacctcagctga

DBGET integrated database retrieval system