KEGG   Rattus norvegicus (rat): 117056
Entry
117056            CDS       T01003                                 

Gene name
H3f3b, H3.3B
Definition
(RefSeq) H3 histone, family 3B
  KO
K11253  histone H3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05034  Alcoholism
rno05202  Transcriptional misregulation in cancer
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    117056 (H3f3b)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    117056 (H3f3b)
  09165 Substance dependence
   05034 Alcoholism
    117056 (H3f3b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    117056 (H3f3b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    117056 (H3f3b)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    117056 (H3f3b)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   117056 (H3f3b)
SSDB
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 117056
NCBI-ProteinID: NP_446437
RGD: 621095
Ensembl: ENSRNOG00000006532
UniProt: P84245 B0BMY8
Position
10q32.1
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggcccgaaccaagcagaccgctaggaagtccaccggagggaaagccccccgcaaacag
ctggccaccaaggcggcccggaaaagcgcgccctctactggcggggtgaagaaacctcat
cgctacaggcccgggaccgtggctctaagagagatccgtcgttaccagaaatcgactgag
ctgctcatccggaagctacccttccagaggttggtgagggagatcgcccaggatttcaaa
accgacttgaggtttcaaagtgcagccatcggtgcccttcaggaggctagcgaggcatac
ctggtggggttgtttgaagataccaatctgtgtgccatccacgccaagagagtcaccatc
atgcccaaagacatccagttggctcgccggatacggggggagagagcttaa

DBGET integrated database retrieval system