KEGG   Rattus norvegicus (rat): 117057
Entry
117057            CDS       T01003                                 

Gene name
Myo1b, Myr1
Definition
(RefSeq) myosin Ib
  KO
K10356  myosin I
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    117057 (Myo1b)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    117057 (Myo1b)
   03036 Chromosome and associated proteins [BR:rno03036]
    117057 (Myo1b)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    117057 (Myo1b)
   04147 Exosome [BR:rno04147]
    117057 (Myo1b)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     117057 (Myo1b)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Others
    117057 (Myo1b)
 Others
  Actin-binding proteins
   Myosins
    117057 (Myo1b)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Chromatin remodeling factors
   B-WICH complex
    117057 (Myo1b)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     117057 (Myo1b)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   117057 (Myo1b)
SSDB
Motif
Pfam: Myosin_head Myosin_TH1 IQ AAA_16 AAA_22
Other DBs
NCBI-GeneID: 117057
NCBI-ProteinID: NP_446438
RGD: 70994
UniProt: Q05096
Structure
PDB: 
4L79 5V7X 6C1D 6C1G 6C1H

Position
9q22
AA seq 1136 aa
MAKKEVKSSLLDNMIGVGDTVLLEPLNEETFIDNLKKRFDHNEIYTYIGSVVISVNPYRS
LPIYSPEKVEDYRNRNFYELSPHIFALSDEAYRSLRDQDKDQCILITGESGAGKTEASKL
VMSYVAAVCGKGAEVNQVKEQLLQSTPVLEAFGNAKTVRNDNSSRFGKYMDIEFDFKGDP
LGGVISNYLLEKSRVVKQPRGERNFHVFYQLLSGASEELLHKLKLERDFSRYNYLSLDSA
KVNGVDDAANFRTVRNAMQIVGFSDPEAESVLEVVAAVLKLGNIEFKPESRMNGLDESKI
KDKNELKEICELTSIDQVVLERAFSFRTVEAKQEKVSTTLNVAQAYYARDALAKNLYSRL
FSWLVNRINESIKAQTKVRKKVMGVLDIYGFEIFEDNSFEQFIINYCNEKLQQIFIELTL
KEEQEEYIREDIEWTHIDYFNNAIICDLIENNTNGILAMLDEECLRPGTVTDETFLEKLN
QVCATHQHFESRMSKCSRFLNDTTLPHSCFRIQHYAGKVLYQVEGFVDKNNDLLYRDLSQ
AMWKAGHALIKSLFPEGNPAKVNLKRPPTAGSQFKASVATLMKNLQTKNPNYIRCIKPND
KKAAHIFSESLVCHQIRYLGLLENVRVRRAGYAFRQAYEPCLERYKMLCKQTWPHWKGPA
RSGVEVLFNELEIPVEEYSFGRSKIFIRNPRTLFQLEDLRKQRLEDLATLIQKIYRGWKC
RTHFLLMKRSQVVIAAWYRRYAQQKRYQQIKSSALVIQSYIRGWKARKILRELKHQKRCK
EAATTIAAYWHGTQARKERRRLKDEARNKHAIAVIWAFWLGSKARRELKRLKEEARRKHA
VAVIWAYWLGLKVRREYRKFFRANAGKKIYEFTLQRIVQKYLLEMKNKMPSLSPIDKNWP
SRPYLFLDSTHKELKRIFHLWRCKKYRDQFTDQQKLIYEEKLEASELFKDKKALYPSSVG
QPFQGAYLEINKNPKYKKLKDAIEEKIIIAEVVNKINRANGKSTSRIFLLTNNNLLLADQ
KSGQIKSEVPLVDVTKVSMSSQNDGFFAVHLKEGSEAASKGDFLFSSDHLIEMATKLYRT
TLSQTKQKLNIEISDEFLVQFRQDKVCVKFIQGNQKNGSVPTCKRKNNRLLEVAVP
NT seq 3411 nt   +upstreamnt  +downstreamnt
atggccaagaaggaggtaaaatcctcacttctggacaatatgatcggcgttggagatacg
gttctcttggagcctctcaacgaggagacgttcatcgacaacctgaagaagcgcttcgat
cacaatgagatatatacatacatcgggagtgtggttatatctgttaacccctaccggtcc
ttgcccatttattcaccagagaaagtggaagattacagaaatagaaacttctatgaactg
agccctcacatctttgctttgtcggatgaagcatacagatccctccgtgatcaagataaa
gatcagtgcattctcattactggggagagtggagcgggaaaaacagaggccagcaagctt
gtgatgtcctatgtcgctgcagtgtgtggaaaaggagcagaagttaatcaggtcaaggaa
cagcttctccagtccacccctgtcctggaagcttttggaaatgccaagactgtaaggaat
gacaattcatccagattcggcaaatacatggatattgaatttgactttaaaggcgatccg
ctgggaggagtgataagtaactatcttttagagaaatctcgtgttgttaagcagccgaga
ggtgaaagaaacttccacgtgttctatcagctgctctcgggtgcctctgaggaactcctc
cacaagcttaaactggagcgggatttcagcagatacaactatctgagtctggactctgcc
aaagtgaatggtgtggacgacgctgccaatttcagaactgtcaggaatgccatgcagatc
gtgggcttttcggatcctgaggccgagtctgtcctggaggttgtggcagctgtcttgaaa
ctggggaacatcgagttcaagcctgaatcacgaatgaacggtttggatgaaagcaaaatc
aaagacaaaaatgagttaaaagaaatttgtgagttgaccagcatcgatcaagtggtttta
gaaagagcgttcagtttccgaacggttgaggcgaagcaggagaaagtttcaaccacattg
aatgtggctcaggcttattatgcccgtgatgccctggctaaaaacctctacagccggttg
ttttcatggttggtaaatcgaatcaacgaaagcattaaggcacaaaccaaagtgagaaag
aaggtcatgggtgttctggacatttatggctttgagatatttgaggacaacagcttcgag
cagttcattattaattattgtaatgaaaagcttcaacaaatcttcattgaactgaccctc
aaagaagagcaagaggaatatattcgtgaggacatagaatggactcacattgactacttc
aacaatgctatcatttgcgacctaatagaaaacaacacaaacggaatcttggccatgctg
gatgaagagtgcctgagacccggcactgttacagatgagaccttcctggaaaagctgaac
caagtctgtgccacccaccagcacttcgagagcaggatgagcaaatgttcccgcttcctc
aatgacacgaccctgcctcacagctgcttcagaatccagcattatgctggcaaggtgcta
taccaggtggaagggtttgttgacaagaacaatgaccttctgtaccgagacctgtctcaa
gccatgtggaaggctggccatgccctcatcaagtctctgttccctgaagggaatcctgca
aaggtcaacctgaaaagacctcctactgcagggtcccagttcaaggcgtcggtggccacc
ctgatgaaaaacctgcagaccaagaacccgaactatatcaggtgcatcaagccgaacgat
aaaaaggccgctcacattttcagtgagagtctcgtgtgccatcagatccggtacctgggt
cttctggagaacgttcgagtgagacgggcaggctatgccttcaggcaggcctatgaacct
tgtctggaaagatacaagatgctttgcaaacaaacatggcctcactggaagggaccagca
aggtctggtgtggaagttctgtttaatgagctagagattcccgtggaagagtactccttc
ggtagatccaagatattcatccgaaacccaaggacattattccaattagaagacctaagg
aagcagcggctggaggacctggccactctcattcagaagatttatcgaggatggaaatgt
cgtacacattttctgctcatgaaaagaagccaagtcgtgattgccgcctggtacaggaga
tacgcgcaacaaaagcgatatcagcagataaagagttcagccctggtgattcagtcttac
atccggggctggaaggctagaaaaatcctgcgggagctgaagcatcagaaacgctgcaag
gaggcagccaccaccatcgcagcatactggcacggcacccaggcgcgaaaggagcggagg
cggctgaaggacgaggctaggaataagcacgctattgcagttatttgggctttctggctt
ggatcgaaggcacgaagggaattgaaacgcttgaaggaggaggctaggcgtaagcatgca
gttgctgtcatttgggcttactggcttggactgaaggtacgaagggagtacaggaaattc
tttagagcaaatgctggaaagaaaatctatgagtttacacttcaaagaattgtgcaaaaa
tacttgttggaaatgaaaaataaaatgccttccttgtcaccaatagataaaaattggcca
tcaagaccttacctattcttggattcgactcacaaggagctaaaaaggatcttccacttg
tggaggtgtaaaaaatacagggatcaattcacagaccagcagaaacttatttatgaagag
aagctggaggccagtgaactcttcaaagacaagaaggctttatatccttctagtgttggt
cagccattccaaggagcttacctggaaatcaacaagaacccaaaatataagaaactcaaa
gatgccattgaagagaagatcattattgctgaggttgtgaacaaaatcaaccgggctaat
gggaagagtacatctcggattttcctcttaacaaacaataaccttctccttgctgaccaa
aagtcggggcagatcaagtccgaggtccccctggtggatgtgactaaggtctccatgagt
tcacagaatgatggtttctttgcagtacacctcaaggagggttcagaagcagctagtaag
ggtgactttctcttcagcagtgaccacctgattgaaatggcaaccaagttgtatcgcacg
actcttagccaaactaaacagaagctcaatatcgagatttccgatgagttcctggtacag
ttcagacaggacaaagtatgtgtgaagtttattcaaggcaaccagaaaaacgggagcgtg
ccaacctgcaaacgaaagaacaacaggcttcttgaagtcgctgtcccttaa

DBGET integrated database retrieval system