KEGG   Rattus norvegicus (rat): 117061Help
Entry
117061            CDS       T01003                                 

Gene name
Mmp10
Definition
(RefSeq) matrix metallopeptidase 10
  KO
K01396  matrix metalloproteinase-10 (stromelysin 2) [EC:3.4.24.22]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    117061 (Mmp10)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.22  stromelysin 2
     117061 (Mmp10)
Peptidases [BR:rno01002]
 Metallo Peptidases
  Family M10
   117061 (Mmp10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Astacin Reprolysin_4 DUF4953 Reprolysin_5 Reprolysin_3
Motif
Other DBs
NCBI-GeneID: 117061
NCBI-ProteinID: NP_598198
RGD: 620192
Ensembl: ENSRNOG00000032832
UniProt: P07152
Position
8q11
AA seq 476 aa AA seqDB search
MEPLAILVLLCFPICSAYPLHGAVRQDHSTMDLAQQYLEKYYNFRKNEKQFFKRKDSSPV
VKKIEEMQKFLGLEMTGKLDSNTVEMMHKPRCGVPDVGGFSTFPGSPKWRKNHISYRIVN
YTLDLPRESVDSAIERALKVWEEVTPLTFSRISEGEADIMISFAVGEHGDFYPFDGVGQS
LAHAYPPGPGFYGDAHFDDDEKWSLGPSGTNLFLVAAHELGHSLGLFHSNNKESLMYPVY
RFSTSQANIRLSQDDIEGIQSLYGARPSSDATVVPVPSVSPKPETPVKCDPALSFDAVTM
LRGEFLFFKDRHFWRRTQWNPEPEFHLISAFWPSLPSGLDAAYEANNKDRVLIFKGSQFW
AVRGNEVQAGYPKRIHTLGFPPTVKKIDAAVFEKEKKKTYFFVGDKYWRFDETRQLMDKG
FPRLITDDFPGIEPQVDAVLHAFGFFYFFCGSSQFEFDPNARTVTHTLKSNSWLLC
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggagccactggccatcctggtgctgctgtgctttccgatctgctcagcatatcctctg
catggggcagtgagacaagaccactcaaccatggatcttgctcagcaatacctagaaaaa
tactacaactttagaaaaaatgagaaacaatttttcaaaagaaaggacagtagtcctgtt
gtcaaaaaaattgaagaaatgcagaagttccttgggctggagatgacagggaagctggac
tcgaacactgtggagatgatgcacaagccccggtgtggtgttcccgacgttggtggcttc
agtacctttccaggttcacccaaatggaggaaaaaccacatctcctacaggattgtgaat
tatacactggatttaccaagagagagtgtggattctgccattgagagagctttgaaggtc
tgggaggaggtgaccccactcacattctccaggatctctgaaggagaggctgacataatg
atctcctttgcagttggagaacatggagacttttacccttttgatggagtgggacagagc
ttggctcatgcctacccacctggccctggattttatggagatgctcacttcgatgatgat
gagaaatggtcactgggaccctcagggaccaatttattcctggttgctgcgcatgaactt
ggtcactccctgggtctctttcactcaaacaacaaagaatctctgatgtacccagtctac
aggttctccacgagccaagccaacattcgcctttctcaggatgatatagagggcattcaa
tccctgtatggagcccgcccctcctctgatgccacagtggttcctgtgccctctgtctct
ccaaaacctgagaccccagtcaaatgtgatcctgctttgtcctttgatgcagtcaccatg
ctgagaggggaattcctattctttaaagacaggcacttctggcgtagaacccagtggaat
cccgagcctgaattccatttgatttcagcattttggccctctcttccttcaggcttagat
gctgcctatgaggcaaataacaaggacagagttctgatttttaaaggaagtcagttctgg
gcagtccgaggaaatgaagtccaagcaggttacccaaagaggatccacactcttggcttt
cctcccaccgtgaagaagattgatgcagctgtttttgaaaaggagaagaagaagacgtat
ttctttgtaggtgacaaatactggagatttgatgagacaagacagcttatggataaaggc
ttcccgagactgataacagatgacttcccaggaattgagccacaagttgatgctgtgtta
catgcatttgggtttttttatttcttctgtggatcatcacagttcgagtttgaccccaat
gccaggacggtgacacacacactgaagagcaacagctggctgttgtgctga

DBGET integrated database retrieval system