KEGG   Rattus norvegicus (rat): 117062
Entry
117062            CDS       T01003                                 

Gene name
Hmga1, Hmgi, Hmgiy
Definition
(RefSeq) high mobility group AT-hook 1
  KO
K09282  high mobility group AT-hook protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    117062 (Hmga1)
   03036 Chromosome and associated proteins [BR:rno03036]
    117062 (Hmga1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Other transcription factors
   HMGI(Y)
    117062 (Hmga1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    117062 (Hmga1)
SSDB
Motif
Pfam: AT_hook
Other DBs
NCBI-GeneID: 117062
NCBI-ProteinID: NP_647543
RGD: 628699
Ensembl: ENSRNOG00000000488
UniProt: Q8K585
Position
20p12
AA seq 107 aa
MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPSVSPGTALVGSQKEPSEVPTPKRPRGR
PKGSKNKGTAKTRKVTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ
NT seq 324 nt   +upstreamnt  +downstreamnt
atgagcgagtcgggctcaaagtccagccagcccctggcctccaagcaggaaaaggatggg
actgagaagcgaggccggggcaggccgcgcaagcagccttcggtgagtcctgggacggcg
ctggtagggagtcagaaggagcccagtgaagtgccaaccccgaagagaccccggggccgg
ccgaagggaagcaagaacaagggcacagccaagacgcggaaagttaccacaactccgggg
aggaaaccaaggggcagacccaagaaactggagaaggaggaagaggagggcatctcccag
gagtcctctgaggaggagcagtga

DBGET integrated database retrieval system