KEGG   Rattus norvegicus (rat): 117064Help
Entry
117064            CDS       T01003                                 

Gene name
Vip, vip/phi27
Definition
(RefSeq) vasoactive intestinal peptide
  KO
K05264  vasoactive intestinal peptide
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    117064 (Vip)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    117064 (Vip)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_2 COG5
Motif
Other DBs
NCBI-GeneID: 117064
NCBI-ProteinID: NP_446443
RGD: 621647
Ensembl: ENSRNOG00000018808
Vega: OTTRNOG00000002330
UniProt: P01283 A0A090BZQ0 B0BNF3
Position
1q11
AA seq 170 aa AA seqDB search
MESRSKPQFLAILTLFSVLFSQSLAWPLYGPPSSVRLDDRLQFEGAGDPDQVSLKADSDI
LQNALAENDTPYYDVSRNARHADGVFTSDYSRLLGQISAKKYLESLIGKRISSSISEDPV
PVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGDSPDFLEELEK
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggaatccagaagcaagcctcagttcctggcgatcctgacactcttcagtgtgctgttc
tcacagtcgctggcctggcctctctatgggccaccttcttcagtgaggttggatgacagg
ctgcagttcgaaggagcaggtgaccctgatcaagtctctttaaaagcagactctgacatc
ttgcagaatgccttagcggagaatgacacgccctattatgatgtgtccagaaatgccagg
catgctgatggagttttcaccagcgactacagtagacttctgggtcagatttctgccaaa
aaataccttgagtcactcattggcaaacgaatcagcagtagcatctcggaagaccccgtg
ccggtcaaacgacactctgatgcagtcttcacagataactacacccgccttagaaagcaa
atggctgtgaagaaatacttgaactccattctaaatgggaagaggagcagtgagggagat
tctccagacttccttgaagagctagagaaatga

DBGET integrated database retrieval system