KEGG   Rattus norvegicus (rat): 117088
Entry
117088            CDS       T01003                                 

Gene name
Adarb2, Adar3, Red2
Definition
(RefSeq) adenosine deaminase, RNA-specific, B2
  KO
K13194  double stranded RNA-specific editase B [EC:3.5.-.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    117088 (Adarb2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.-  Acting on carbon-nitrogen bonds, other than peptide bonds
    3.5.-.-  
     117088 (Adarb2)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    117088 (Adarb2)
SSDB
Motif
Pfam: A_deamin dsrm
Other DBs
NCBI-GeneID: 117088
NCBI-ProteinID: NP_579836
RGD: 621519
Ensembl: ENSRNOG00000030775
UniProt: P97616
Position
17q12.1
AA seq 746 aa
MASVLGSGRGSGGLSSQLKCKSKRRRRRRSKRKDKVSILSTFLAPFKYLSPGTTNTEDED
NLSTSSAEVKENRNVSNLGTRPLPPGDWARGGSTPSVKRKRPLEEGNGGHFCKLQLIWKK
LSWSMTPKNALVQLHELKPGLQYRMVSQTGPVHAPVFAVAVEVNGLTFEGTGPTKKKAKM
RAAEMALKSFVQFPNAFQAHLAMGSSTSPCTDFTSDQADFPDTLFKEFEPSSRNEDFPGC
CPVDTEFLSSAYRRGRLLYHTLDLMGQALPDRSRLAPGALGERNPVVVLNELRSGLRYVC
LSETAEKPRVKSFVMAVCVDGRTFEGSGRSKKLAKGQAAQAALQALFDIRLPGHIPSRSK
SNLLPQDFADSVSQLVTQKFRELTVGLTSVYARHKTLAGIVMTKGLDTKQAQVIVLSSGT
KCISGEHISDQGLVVNDCHAEIVARRAFLHFLYTQLELHLSKHQEDPERSIFIRVKEGGY
RLRENILFHLYVSTSPCGDARLNSPYEITIDLNSSKHIVRKFRGHLRTKIESGEGTVPVR
GPSAVQTWDGILLGEQLVTMSCTDKIASWNVLGLQGALLCHFIEPVYLHSIIVGSLHHTG
HLARVMSHRMEGIGQLPASYRQNRPLLSGVSNAEARQPGKSPHFSANWVVGSADLEIINA
TTGKRSCGGSSRLCKHVFSARWARLHGRLSTRIPGHGDTPSMYCEAKRGAHTYQSVKQQL
FKAFQKAGLGTWVRKPPEQDQFLLSL
NT seq 2241 nt   +upstreamnt  +downstreamnt
atggcatctgtcctggggagtggcagagggtctggagggctaagcagtcagctcaaatgc
aagtccaagaggagaaggaggagaaggtccaagaggaaagacaaagtcagcatactgtca
accttcctcgctcctttcaagtacctaagtcctggcaccacaaacacggaggatgaagac
aatctgagtaccagcagtgctgaagtgaaagaaaaccgaaatgtgagcaaccttgggacc
aggcccctgccccctggagactgggccagaggcggcagcacacccagcgttaaaaggaaa
aggccgctggaggaaggaaatgggggacatttctgcaaactgcagctgatctggaaaaaa
ctctcctggtctatgacacccaagaatgcgctggtccagctacatgagctgaagccgggt
cttcagtaccggatggtgtcacagactggcccagtgcacgccccagttttcgccgtggct
gtagaagtaaacgggctcacgtttgaaggcacggggcccactaagaagaaggccaagatg
cgggcagcagagatggccctgaagtccttcgtgcagttccccaatgcattccaggcccac
ctggctatgggcagtagtaccagtccgtgcactgacttcacctctgaccaagctgacttc
ccagacacgttgttcaaggagttcgaaccatcctcaagaaacgaggatttcccgggctgc
tgtcccgttgacactgagtttctgtcctctgcctaccggcgaggacggctgctctaccac
acactggacctcatgggccaggctctgcctgacaggtccaggctggctccaggggcactg
ggtgagagaaaccctgtagtggtgttgaatgaattacgctcaggtcttcggtatgtgtgc
ctctccgagacagccgagaagccccgagtcaagagctttgtcatggctgtgtgcgtggac
gggaggacgttcgaaggctctggacgcagtaagaagctggccaagggccaagcagcacaa
gctgccttgcaggccctcttcgacatccggctgccaggtcacatacccagcaggagtaaa
agcaacctcttgccacaggattttgcagactctgtgtctcagctggtcacacagaagttc
cgtgaactgacagtcggcctgacatctgtgtatgcccgccacaaaacactggcaggaatc
gtcatgaccaaaggcttggacaccaaacaagcacaggtcatcgttctgtcctctgggacc
aagtgtatcagcggtgagcacatcagtgaccaggggctggttgtcaacgactgtcacgct
gagattgtggcaaggcgagcatttcttcacttcctctacactcagctggagctgcacttg
agcaagcatcaagaggaccccgagagatcaatattcatccgtgtaaaggaaggaggctac
aggctgcgagaaaacatcctcttccacctctacgtgagcacatccccttgtggagacgcc
agactcaactctccctatgaaatcaccatagacttgaacagcagcaaacacatcgtcagg
aagttccgagggcacctgcgcaccaagattgagtctggggaaggaacagtccctgtgcgg
ggccccagtgcagtccagacatgggatggcatcctgctgggggagcagctagtcaccatg
tcctgcacagacaagattgccagctggaatgtgctgggactacaaggcgctctcctctgt
cacttcatcgagcctgtgtacctccatagcatcattgtgggaagcctgcatcacacgggc
caccttgcacgggtcatgagccacaggatggagggcatcggccaactgcctgcctcatac
cgacaaaacaggcctctccttagtggtgtgagtaacgccgaggcccggcagccaggaaag
tctccccacttcagtgccaactgggtcgtaggcagtgccgacctggagatcattaatgcc
acaactgggaagaggagctgtgggggttcatcccggctctgcaagcacgtgttttctgct
cggtgggcacggctgcatggtaggctaagcacacggatcccaggccacggagacacaccc
tccatgtactgtgaagccaagcggggggctcacacctaccagtctgttaaacagcagctc
ttcaaggcttttcagaaagctggtcttggcacctgggtgagaaagccaccagagcaagat
cagtttctactaagtctctaa

DBGET integrated database retrieval system