KEGG   Rattus norvegicus (rat): 117095
Entry
117095            CDS       T01003                                 

Gene name
Bhlhe41
Definition
(RefSeq) class E basic helix-loop-helix protein 41
  KO
K03730  class B basic helix-loop-helix protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    117095 (Bhlhe41)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    117095 (Bhlhe41)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    117095 (Bhlhe41)
SSDB
Motif
Pfam: HLH Hairy_orange Oscp1
Other DBs
NCBI-GeneID: 117095
NCBI-ProteinID: XP_038964817
RGD: 70900
Ensembl: ENSRNOG00000048961
Position
4
AA seq 410 aa
MDEGIPHLQERQLLEHRDFIGLDYSSLYMCKPKRSLKRDDTKDTYKLPHRLIEKKRRDRI
NECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQQHQKIIALQNGERSL
KSPVQADLDAFHSGFQTCAKEVLQYLARFESWTPREPRCAQLVSHLHAVATQLLTPQVTP
GRGPGRAPCSAGAAAASGSERVARCVPVIQRTQPGTEPEHDTDTDSGYGGEAEQGRAAVK
QEPPGDPSPAPKRLKLEARGALLGPEPALLGSLVALGGGAPFAQPAAAPFCLPFYLLSPS
AAAYVQPWLDKSGLDKYLYPAAAAPFPLLYPGIPAAAAAAAAAAFPCLSSVLSPPPEKAG
SAAGAPFLAHEVAPPGSLRPQHAHSRTHLPHAVNPESSQEDATQPAKDAP
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggacgaaggaatccctcatttgcaagagagacagttactggaacatagggattttata
ggactggactattcctctttgtatatgtgtaaacccaaaaggagcttgaagcgagacgac
accaaggatacctacaaattaccgcacagattaatagaaaagaagagacgagaccgaatt
aatgaatgtattgctcagctgaaagacttactgcctgaacatctgaaattgacaacactg
gggcatctggagaaagcagtagtcttggaattaactttgaagcacttaaaagctttaaca
gccttaacggagcagcagcatcagaagataattgctttacagaatggggagcgctctctg
aaatcgccggtccaggccgacttggatgcgttccactcggggtttcaaacctgcgccaaa
gaagtcttgcaatacctcgcgcgctttgagagctggacgcccagggaaccgcgctgcgca
cagctcgtcagccacctgcacgctgtggctacccagcttctgacgccacaggtgacccca
ggcaggggccctgggcgcgcgccctgcagcgctggggctgcagccgcctccggttccgag
cgcgtcgcccgctgcgtgccggtcatccagcggactcagcccggcacggagcccgagcac
gacacggacaccgacagcggctatggaggcgaggcggagcagggccgcgccgccgtcaag
caggagccacccggggacccgtcgcctgcgcccaagaggctgaagctggaggcgcgcggc
gcgctcctgggcccggagcccgcgctgctcggctctctcgtggcgttgggcgggggtgcg
cccttcgcgcagcccgccgccgcgcccttctgcctgcccttctacctgctgtcgccgtcc
gccgccgcctacgtacagccctggctagacaagagtggcctggacaagtatctgtacccc
gcggcggccgcgcccttcccgctgctgtatcccggcatccccgcagcagccgccgctgcc
gccgccgccgctttcccttgcttgtcgtccgtgctatcgccacccccggagaaggcaggt
tcggccgctggtgccccattcctggcgcacgaggtggcgcccccggggtcgctgcgcccc
cagcacgcgcatagccgcacccacctgccgcacgccgtgaacccagagagctctcaggaa
gatgccacgcagccggccaaggacgccccctga

KEGG   Rattus norvegicus (rat): 79431
Entry
79431             CDS       T01003                                 

Gene name
Bhlhe40
Definition
(RefSeq) class E basic helix-loop-helix protein 40
  KO
K03729  class B basic helix-loop-helix protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    79431 (Bhlhe40)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    79431 (Bhlhe40)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    79431 (Bhlhe40)
SSDB
Motif
Pfam: HLH Hairy_orange Oscp1
Other DBs
NCBI-GeneID: 79431
NCBI-ProteinID: NP_445780
RGD: 68439
Ensembl: ENSRNOG00000007152
UniProt: O35780 Q76JQ4
Position
4
AA seq 411 aa
MERIPSAQPPPTCLPKTPGLEHGDLSGMDFAHMYQVYKSRRGIKRSEDSKETYKLPHRLI
EKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIMA
LQSGLQAGDLSGRNIEAGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVS
ELLQGSASRKPLDSAPKPVDFKEKPSFLAKGSEGPGKNCVPVIQRTFAPSGGEQSGSDTD
TDSGYGGELEKGDLRSEQPYFKSDHGRRFTVGERVSTIKQESEEPPTKKSRMQLSDEEGH
FVGSDLMGSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPLLYPGLNTSAA
ALSSFMNPDKIPTPLLLPQRLPSPLAHSSLDSSALLQALKQIPPLNLETKD
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggagcggatccccagcgcgcaaccacctcctacctgcctgcccaaaacgccagggctg
gagcacggagacctgtcagggatggattttgcccacatgtaccaagtgtacaagtccagg
cggggaataaaacggagcgaggacagcaaggaaacttacaaattgccgcaccggttgatt
gagaaaaagagacgtgaccggattaacgagtgcattgcccagctgaaggatctcctaccc
gaacatctcaaacttactactttgggtcacttggagaaagcagtggttctcgagctgacg
ctgaagcacgtgaaagcattgacaaacctaattgatcagcagcagcagaaaatcatggcc
ctgcagagcggtttacaagctggtgatctgtcgggaagaaatattgaggcaggacaagaa
atgttctgctccggtttccagacctgtgcccgggaggtacttcagtacctggccaagcat
gaaaacactagggacctgaagtcttcccagcttgtcactcatctccaccgtgtggtctct
gaactcctgcagggtagtgcttccaggaaaccattggactcagctcccaaacccgtggac
ttcaaagagaagcccagcttcctagccaagggatcagaaggccctgggaaaaactgtgtg
ccagtcatccagaggacttttgctccctcgggcggggagcagagtggtagtgacacggac
acagacagtggctacggaggcgaattggagaagggtgacttgcgcagtgagcaaccctac
ttcaagagcgatcacggacgcaggttcaccgtgggagaacgcgtcagcacaattaagcaa
gaatctgaagagccccccaccaaaaagagccgaatgcagctctcagatgaggaaggccac
ttcgtgggcagtgacctgatgggttccccatttcttgggcctcacccacatcagcctccc
ttttgcctgcccttctatctcatcccaccatcggccactgcctatctgcctatgctggag
aaatgctggtatccgacctctgtgccactgttatacccaggcctcaacacctcagcagca
gccctctccagcttcatgaacccagacaagatcccaactcccttgctcctgccccagaga
ctcccttctcccttggcacattcgtcccttgactcttcagccttgctccaggccctgaag
cagatccctcctttaaacttagaaaccaaagactaa

DBGET integrated database retrieval system