KEGG   Rattus norvegicus (rat): 117098
Entry
117098            CDS       T01003                                 

Gene name
Pdha2, Pdhal
Definition
(RefSeq) pyruvate dehydrogenase (lipoamide) alpha 2
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00020  Citrate cycle (TCA cycle)
rno00620  Pyruvate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno04066  HIF-1 signaling pathway
rno04922  Glucagon signaling pathway
rno05230  Central carbon metabolism in cancer
Module
rno_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    117098 (Pdha2)
   00020 Citrate cycle (TCA cycle)
    117098 (Pdha2)
   00620 Pyruvate metabolism
    117098 (Pdha2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    117098 (Pdha2)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    117098 (Pdha2)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    117098 (Pdha2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     117098 (Pdha2)
SSDB
Motif
Pfam: E1_dh TPP_enzyme_C DXP_synthase_N DUF2776
Other DBs
NCBI-GeneID: 117098
NCBI-ProteinID: NP_446446
RGD: 620095
Ensembl: ENSRNOG00000016223
UniProt: Q06437
Position
2q44
AA seq 391 aa
MRKMLATVLSQVFSGMVQKPALRGLLSSLKFSNDATCDIKKCDLYLLEQGPPTSTVLTRE
EALKYYRNMQVIRRMELKADQLYKQKFIRGFCHLCDGQEACNVGLEAGINPTDHIITSYR
AHGLCYTRGLSVKSILAELTGRKGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGVAL
ACKYLKNGQICLALYGDGAANQGQVFEAYNMSALWKLPCVFICENNRYGMGTAIERSAAS
TDYHKKGFVIPGLRVNGMDILSVREATKFAADHCRSGKGPIVMELQTYRYHGHSMSDPGI
SYRTREEVQNVRSKSDPIMLLRERMISNNLSSVEELKEIDADVKKEVEEAAQFATTDPEP
PLEDLANYLYHQNPPFEVRGAHKWLKFKSVS
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgaggaaaatgctggccactgtgctgtctcaagtattttcaggaatggtccagaagcca
gctctcaggggactgctgtcatctcttaagttctccaacgacgccacctgtgacatcaag
aaatgcgacttgtacctgttggaacagggcccccccacctccactgtgctcaccagagag
gaggccctgaaatactaccggaacatgcaggtaattcggcgcatggagttgaaggccgac
cagctgtataagcagaaattcatccgtggtttctgtcacctgtgtgatgggcaggaagcc
tgcaatgtggggctggaggcagggataaatcccacagaccacatcatcacgtcctacaga
gctcatggcttgtgctacacgaggggactgtcagtgaagtccattctcgcagagctgact
ggacgcaaaggaggctgtgctaaaggcaagggaggctctatgcacatgtacgccaagaac
ttctatgggggcaatggcattgttggggcacaggtacccctgggagctggtgtggctctc
gcctgtaaatacctgaagaatggtcagatctgcttggctttgtatggcgatggtgcggct
aaccaagggcaggtatttgaagcttacaatatgtcagccttgtggaaattaccctgtgtt
ttcatctgtgagaataaccgctatggaatgggaacagctattgagagatcagcagccagt
actgattaccacaagaaaggctttgttatccctggactgagggtgaatgggatggatatt
ctcagtgttcgtgaggcgaccaagtttgcagctgatcactgcagatccggaaaggggccc
attgtgatggagttgcagacataccgttatcatggacacagtatgagcgatccagggatc
agttatcgtacacgagaagaagttcagaacgtgaggagtaagagtgatccaataatgctt
ctccgagagagaatgataagcaacaacctcagcagtgttgaagaattgaaagaaattgat
gcagatgtgaagaaagaagtcgaggaagcagctcagtttgctacaactgatccagaacca
cctctggaagatttagccaattacctctaccaccaaaatccaccatttgaagtccgtggt
gcacataaatggctgaagtttaagtctgtcagttag

DBGET integrated database retrieval system