KEGG   Rattus norvegicus (rat): 117099Help
Entry
117099            CDS       T01003                                 

Gene name
Bdh1, Bdh
Definition
(RefSeq) 3-hydroxybutyrate dehydrogenase 1
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00072  Synthesis and degradation of ketone bodies
rno00650  Butanoate metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    117099 (Bdh1)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    117099 (Bdh1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     117099 (Bdh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR Eno-Rase_NADH_b
Motif
Other DBs
NCBI-GeneID: 117099
NCBI-ProteinID: NP_446447
RGD: 620131
Ensembl: ENSRNOG00000001736
UniProt: P29147 A0A0G2JSH2
Position
11q22
AA seq 344 aa AA seqDB search
MMLAARLSRPLSQLPGKALSVCDRENGTRHTLLFYPASFSPDTRRTYTSQADAASGKAVL
VTGCDSGFGFSLAKHLHSKGFLVFAGCLLKDKGDAGVRELDSLKSDRLRTIQLNVCNSEE
VEKAVETVRSGLKDPEKGMWGLVNNAGISTFGEVEFTSMETYKEVAEVNLWGTVRTTKSF
LPLLRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMHPLGVKVSVVEPG
NFIAATSLYSPERIQAIAKKMWDELPEVVRKDYGKKYFDEKIAKMETYCNSGSTDTSSVI
NAVTHALTAATPYTRYHPMDYYWWLRMQVMTHFPGAISDKIYIH
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgatgctggccgcccgtctttccagacccctgtcacagctcccaggaaaagctctaagt
gtctgtgatagagaaaatgggacaagacacacactgttgttttacccagcttctttcagc
cctgacacccgtcggacctacaccagtcaggcagatgcggctagtggcaaagctgtcctg
gttacaggctgtgactctggatttgggttctctttggccaagcatctacactcaaaaggt
ttccttgtatttgctggatgtttgttgaaggacaaaggcgatgctggggtcagggagctg
gacagcctgaagagtgaccggctgagaaccatccagctcaatgtctgcaacagtgaggag
gtggagaaagcggtggagaccgtccgctccggcctgaaggatcctgagaagggaatgtgg
ggcctggttaacaacgcaggcatctcaacgtttggggaggtggagttcactagcatggag
acgtataaggaggtggccgaagtgaacctctggggaactgtgcgcacaacaaaatccttc
cttccccttctccgaagagccaaaggccgtgttgttaacatcagcagcatgctgggtcgc
atggccaacccagcccgctcaccatactgcatcaccaagtttggggtagaggctttctcg
gactgcctacgctatgagatgcaccctctgggtgtgaaggtcagtgtggtggagcctggc
aacttcatagctgccaccagcctctatagccctgagcgtatccaggccattgccaagaag
atgtgggatgagctgccagaggtcgtccgcaaagactatggcaagaagtacttcgatgaa
aagattgccaagatggagacctactgcaacagcggttccaccgatacgtcctccgtcatc
aacgctgtcacccatgccctgactgctgccaccccttatacccgctaccatcccatggac
tactactggtggctgcggatgcaggtcatgacccattttcctggagccatctctgacaag
atctacatacactga

DBGET integrated database retrieval system