KEGG   Rattus norvegicus (rat): 117100
Entry
117100            CDS       T01003                                 

Symbol
Slc6a7
Name
(RefSeq) sodium-dependent proline transporter
  KO
K05040  solute carrier family 6 (neurotransmitter transporter, L-proline) member 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    117100 (Slc6a7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    117100 (Slc6a7)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   117100 (Slc6a7)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 117100
NCBI-ProteinID: NP_446448
RGD: 620928
Ensembl: ENSRNOG00000018644
UniProt: P28573 G3V8F1
Position
18
AA seq 637 aa
MKKLQEAHLRKPVTPDLLMTPSDQGDVDLDVDFAADRGNWTGKLDFLLSCIGYCVGLGNV
WRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGA
AMLLIVGLVAIYYNMIIAYVLFYLFASLTSNLPWEHCGNWWNTERCLEHRGPKDGNGALP
LNLSSTVSPSEEYWSRYVLHIQGSQGIGRPGEIRWNLCLCLLLAWVIVFLCILKGVKSSG
KVVYFTATFPYLILLMLLVRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLG
VGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFAIFSVLGYMSQELGVPVDQVA
KAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFLETIVTAVTDEFPYYLR
PKKAVFSGLICVAMYLMGLILTTDGGMYWLVLLDDYSASFGLMVVVITTCLAVTRVYGIQ
RFCRDIHMMLGFKPGLYFRACWLFLSPATLLALLVYSIVKYQPSEYGSYRFPAWAELLGI
LMGLLSCLMIPAGMLVAVLREEGSLWERLQQASRPAIDWGPSLEENRTGMYVATLAGSQS
PKPLMVHMRKYGGITSFENTAIEVDREIAEEEEESMM
NT seq 1914 nt   +upstreamnt  +downstreamnt
atgaagaagctccaggaagctcacctccgcaagcctgtcaccccagacctgctgatgact
cccagtgaccagggtgatgtggacctggatgtagactttgcagcagacagaggcaactgg
acgggcaagctggacttcttgctgtcctgcatcggctactgtgtgggcttgggaaatgtc
tggcggtttccctatcgagcctacaccaatggaggcggagccttcctcgtgccctacttc
ctcatgctggccatctgtggcatccccctcttctttcttgagctctccctgggccagttc
tccagcctgggacccctggctgtctggaaaatcagccccctcttcaaaggtgcgggtgca
gccatgctgctcatcgtgggcctggtggccatctactacaacatgatcatcgcctacgtc
ctcttctacctcttcgcctccctcaccagcaacctgccctgggagcattgcggcaactgg
tggaacacagaacgctgcctggagcacagaggccccaaggatggcaacggggcactgcct
cttaacctcagcagcactgtcagccccagtgaggagtactggagccgatatgtcctgcac
attcagggcagccagggcatcggccgacccggggagattcgctggaacctctgcctctgc
ctgctgctggcctgggtcatcgtgtttctctgtatcctgaagggggtgaagtcctcgggc
aaggtggtgtatttcacagccacctttccctacctcatcctgctcatgctcctggttcga
ggagtgacccttcccggggcctggaagggcatccagttctatctcaccccccaattccac
cacctgctgtcttccaaggtgtggattgaagctgctcttcagatcttctactctctagga
gtgggttttgggggtcttctcacctttgcctcctacaacacattccaccagaacatctac
agagacaccttcattgtcactctgggcaatgccatcaccagcatcctggctggttttgct
atcttctcggtgctgggctacatgtcgcaggagctgggtgtgcctgtggaccaagtggcc
aaagcaggccctggcctggcctttgttgtctacccacaggccatgactatgttgcctctg
tcacccttctggtccttcctcttcttcttcatgcttctgactcttggcctcgatagccag
tttgcctttctggaaaccatagtgactgcagtgaccgatgagttcccatactacctacgg
cccaagaaggcagtgttctcaggcctcatctgtgtagccatgtacctgatgggactgatc
ctcaccaccgatggggggatgtactggctggtccttctggatgactacagcgccagcttc
ggactcatggtggtggtgattaccacatgcctcgctgtcacccgggtatacggcatccag
cggttttgtcgtgacatccacatgatgctgggcttcaagccaggactctacttcagggcc
tgctggctgtttttgtctccggccacactcttggccttgctggtgtacagtatcgtcaag
taccagccctcggaatacggtagctatcgcttccccgcctgggccgagctgctaggcatc
ctgatgggcctgctctcctgcctcatgatcccagctggcatgctggtagctgtgcttcga
gaggagggctcgctctgggagcgacttcagcaagccagccgtcctgctatagactggggc
ccatcactggaagagaaccggacgggcatgtatgtggccaccctggctgggagccagtca
ccaaaaccactgatggtacacatgcgaaaatatgggggcatcaccagcttcgagaataca
gccattgaggtggaccgtgagatcgcagaggaggaagaggagtccatgatgtga

DBGET integrated database retrieval system