KEGG   Rattus norvegicus (rat): 117104
Entry
117104            CDS       T01003                                 

Gene name
Ppp2r2a
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03015  mRNA surveillance pathway
rno04071  Sphingolipid signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04390  Hippo signaling pathway
rno04530  Tight junction
rno04728  Dopaminergic synapse
rno05142  Chagas disease
rno05160  Hepatitis C
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    117104 (Ppp2r2a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    117104 (Ppp2r2a)
   04071 Sphingolipid signaling pathway
    117104 (Ppp2r2a)
   04151 PI3K-Akt signaling pathway
    117104 (Ppp2r2a)
   04152 AMPK signaling pathway
    117104 (Ppp2r2a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    117104 (Ppp2r2a)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    117104 (Ppp2r2a)
  09156 Nervous system
   04728 Dopaminergic synapse
    117104 (Ppp2r2a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    117104 (Ppp2r2a)
   05165 Human papillomavirus infection
    117104 (Ppp2r2a)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    117104 (Ppp2r2a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    117104 (Ppp2r2a)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    117104 (Ppp2r2a)
   03036 Chromosome and associated proteins [BR:rno03036]
    117104 (Ppp2r2a)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     117104 (Ppp2r2a)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     117104 (Ppp2r2a)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     117104 (Ppp2r2a)
SSDB
Motif
Pfam: ANAPC4_WD40
Other DBs
NCBI-GeneID: 117104
NCBI-ProteinID: NP_446451
RGD: 620919
Ensembl: ENSRNOG00000011158
UniProt: P36876
Position
15
AA seq 447 aa
MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQE
NKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIK
LWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHI
NSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCN
TFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYM
MTRDYLSVKVWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTG
SYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKIL
HTAWHPKENIIAVATTNNLYIFQDKVN
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggcaggagctggaggagggaatgatattcaatggtgtttttctcaggtgaaaggagca
gttgatgatgacgtagcagaagcagatataatttctacagtagagtttaatcattctgga
gaattactagccacaggagataaaggtgggagagtcgtcatctttcaacaagagcaggag
aacaaaatccagtctcatagcagaggagaatacaatgtttacagcaccttccagagccat
gagccagaatttgactacttgaaaagcttagaaatagaagagaagatcaacaaaattagg
tggttaccccagaaaaatgctgcccagtttttattgtctaccaatgataaaacaataaaa
ttatggaaaatcagtgaaagagacaaaagaccagaaggctataacttgaaagaggaagat
ggaaggtatagagaccctactacagtcactacactacgagtgccggtgtttaggcccatg
gatctaatggtggaggccagtccgcggagaatatttgccaacgcccatacctaccacatc
aactccatttctatcaatagtgattatgaaacctacttatcagcagatgatttgcgaatt
aatctctggcatctggaaattacagacaggagttttaatattgtggacattaagcctgcc
aatatggaggagctcacggaggtgatcacagccgcagagttccatcccaacagctgtaac
acgtttgtgtacagcagcagtaaagggaccattcgcttatgtgacatgagggcatctgca
ctctgtgacaggcattctaaactgtttgaagaacccgaagatcccagcaacaggtcgttt
ttttctgaaatcatctcctcaatttctgatgtaaaattcagccacagtggtcgctatatg
atgactagagactatttgtcagtcaaagtttgggacttgaatatggaaaacaggcccgtg
gagacataccaggtacacgaatacctcagaagtaaactttgctcactgtatgaaaacgac
tgcatatttgacaaatttgaatgttgttggaatgggtctgacagtgttgtcatgactgga
tcctacaataatttcttcagaatgttcgacaggaacacaaagcgggatataactctagaa
gcatcgcgagaaaacaataagcctcgtacagttttgaaaccacgcaaagtctgtgcaagt
ggcaagcgaaagaaagatgaaataagtgttgacagtctagacttcaacaagaaaatcctt
catacagcctggcatcccaaggaaaacatcattgctgtagcgactacaaacaatctgtat
atatttcaagacaaagtgaattag

KEGG   Rattus norvegicus (rat): 117256
Entry
117256            CDS       T01003                                 

Gene name
Ppp2r2c
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03015  mRNA surveillance pathway
rno04071  Sphingolipid signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04390  Hippo signaling pathway
rno04530  Tight junction
rno04728  Dopaminergic synapse
rno05142  Chagas disease
rno05160  Hepatitis C
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    117256 (Ppp2r2c)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    117256 (Ppp2r2c)
   04071 Sphingolipid signaling pathway
    117256 (Ppp2r2c)
   04151 PI3K-Akt signaling pathway
    117256 (Ppp2r2c)
   04152 AMPK signaling pathway
    117256 (Ppp2r2c)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    117256 (Ppp2r2c)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    117256 (Ppp2r2c)
  09156 Nervous system
   04728 Dopaminergic synapse
    117256 (Ppp2r2c)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    117256 (Ppp2r2c)
   05165 Human papillomavirus infection
    117256 (Ppp2r2c)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    117256 (Ppp2r2c)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    117256 (Ppp2r2c)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    117256 (Ppp2r2c)
   03036 Chromosome and associated proteins [BR:rno03036]
    117256 (Ppp2r2c)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     117256 (Ppp2r2c)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     117256 (Ppp2r2c)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     117256 (Ppp2r2c)
SSDB
Motif
Pfam: BSMAP
Other DBs
NCBI-GeneID: 117256
NCBI-ProteinID: NP_476457
RGD: 620920
UniProt: P97888
Position
14
AA seq 447 aa
MGEDTDTRKINHSFLRDHSYVTEADVISTVEFNHTGELLATGDKGGRVVIFQREPESKNA
PHSQGEYDVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKLWKI
TERDKRPEGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRIFANGHTYHINSIS
VNSDCETYMSADDLRINLWHLAITDRSFNIVDIKPANMEDLTEVITASEFHPHHCNLFVY
SSSKGSLRLCDMRAAALCDKHSKLFEEPEDPSNRSFFSEIISSVSDVKFSHSGRYMLTRD
YLTVKVWDLNMEARPIETYQVHDYLRSKLCSLYESDCIFDKFECAWNGSDSVIMTGAYNN
FFRMFDRNTKRDVTLEASRESSKPRAVLKPRRVCVGGKRRRDDISVDSLDFTKKILHTAW
HPAENIIAIAATNNLYIFQDKVNSDMH
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgggcgaggacacggacacgcggaaaattaaccacagcttcctgcgggaccacagctat
gtgacagaagctgacgtcatctccactgtcgagttcaaccacactggggaactgctggcc
acaggtgacaagggtggccgggtggttatcttccagcgggaaccagagagtaagaatgca
cctcacagccagggtgagtacgatgtgtacagcaccttccagagccacgagcctgagttt
gactacctgaaaagcctggagatagaggagaaaatcaacaagatcaaatggctcccgcag
cagaacgccgcccactcgctgctgtccaccaatgataaaactattaaattatggaagatt
accgagcgagacaagaggcccgagggctacaacctgaaggatgaggaggggaagctgaaa
gacctgtccacagtgacgtcactgcaggtgcctgtgctgaagcccatggacttaatggtg
gaagtgagcccgagaaggatctttgccaatggccacacctaccacatcaactccatctcc
gtcaacagcgactgcgagacgtacatgtcagcggacgacctgcgcattaacctctggcat
ctggccatcactgatcggagcttcaacatcgtagacatcaagccagccaacatggaggac
ctcacggaggtgatcacagcatctgagttccatccgcaccactgcaacctcttcgtctac
agcagcagcaagggctccctgcggctctgtgacatgcgggcagctgccctgtgcgacaag
cactccaagctctttgaagagcccgaggaccccagcaaccgctccttcttctcagagatc
atctcctcggtgtccgacgtgaagttcagccacagtgggcgctacatgctcacgagggat
tacctcactgtcaaggtctgggacctgaacatggaggcgaggcccatagagacctaccag
gtccatgactacctgcggagtaagctctgctccctgtatgagagtgactgcatcttcgac
aagtttgagtgtgcctggaatgggagtgacagtgtcatcatgacaggggcctacaacaac
ttcttccgaatgtttgaccgcaacaccaagcgggatgtgacgctggaggcctcgagggag
agcagcaaacccagagcggtgctcaagccaaggcgcgtgtgtgtgggtggcaagcggcgg
cgtgatgacatcagtgtggacagcttggacttcaccaagaagatcctgcacacggcctgg
cacccagcggagaacatcattgccattgcagccaccaacaacctgtacatcttccaggat
aaggtcaattctgacatgcactag

KEGG   Rattus norvegicus (rat): 117281
Entry
117281            CDS       T01003                                 

Gene name
Ppp2r1a
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03015  mRNA surveillance pathway
rno04071  Sphingolipid signaling pathway
rno04114  Oocyte meiosis
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04350  TGF-beta signaling pathway
rno04390  Hippo signaling pathway
rno04530  Tight junction
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno05142  Chagas disease
rno05160  Hepatitis C
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    117281 (Ppp2r1a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    117281 (Ppp2r1a)
   04390 Hippo signaling pathway
    117281 (Ppp2r1a)
   04071 Sphingolipid signaling pathway
    117281 (Ppp2r1a)
   04151 PI3K-Akt signaling pathway
    117281 (Ppp2r1a)
   04152 AMPK signaling pathway
    117281 (Ppp2r1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    117281 (Ppp2r1a)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    117281 (Ppp2r1a)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    117281 (Ppp2r1a)
  09156 Nervous system
   04728 Dopaminergic synapse
    117281 (Ppp2r1a)
   04730 Long-term depression
    117281 (Ppp2r1a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    117281 (Ppp2r1a)
   05165 Human papillomavirus infection
    117281 (Ppp2r1a)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    117281 (Ppp2r1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    117281 (Ppp2r1a)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    117281 (Ppp2r1a)
   03036 Chromosome and associated proteins [BR:rno03036]
    117281 (Ppp2r1a)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     117281 (Ppp2r1a)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     117281 (Ppp2r1a)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     117281 (Ppp2r1a)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Cnd1 Adaptin_N CLASP_N TAF6_C M11L Spore_Cse60
Other DBs
NCBI-GeneID: 117281
NCBI-ProteinID: NP_476481
RGD: 620907
Ensembl: ENSRNOG00000011282
UniProt: Q5XI34
Position
1
AA seq 589 aa
MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY
DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS
PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM
VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL
EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSADCRENVIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDN
TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA
TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV
AKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggcagctgccgacggcgacgattcgctctaccccattgcggtgctcatagatgaactg
cgcaatgaggacgttcagcttcgtctcaatagtatcaagaagctctccaccattgccttg
gcccttggggttgaacggaccagaagtgagctcctgccctttcttacagataccatctat
gatgaagatgaggtcctcttggctttggctgaacagctgggaaccttcaccactttggtg
ggaggacccgagtatgtgcactgtctgctgccacctcttgagtcactggccacagtggaa
gagacagtagtgcgagacaaggcggtagaatccttgcgggccatctctcatgagcactca
ccttccgatctagaggctcactttgtgcctctggtgaagcggctggcgggtggagactgg
ttcacctcccgtacctcagcctgtggtctcttctcagtttgctacccccgagtatccagt
gccgtgaaggcagaacttcgacagtacttccggaacctgtgctcagatgatacccccatg
gtgcggcgggccgctgcctccaagctgggggagtttgccaaggtactggagctggacaat
gtcaagagtgagatcattcccatgttctctaacctggcctctgacgagcaggactcggtg
cggctgctggcagtagaggcatgcgtgaatatcgcccagcttctgccccaggaggacctg
gaggccttagtgatgcccaccttgcgacaggctgctgaggacaagtcttggcgtgtccgc
tacatggtggcagacaaattcacagagctccagaaagcagttgggcctgagatcactaag
acagatctggtgcctgccttccagaacctgatgaaagactgtgaggccgaggtgagggcc
gcagcctcccacaaggtcaaagagttctgtgaaaatctctcagctgactgccgggagaat
gtgatcatgacccagatcttgccctgcatcaaggaactcgtgtccgatgccaaccaacat
gtcaagtcagcactggcttcagtcatcatgggcctctctcccattctgggcaaagacaat
accatcgaacacctcttgcccctgttcttggctcagctgaaggatgagtgtcctgaggtg
cggctgaacatcatttccaacctggattgtgtgaatgaagtgattggcatccggcagctc
tcgcagtccttgcttcctgccatcgtggaactcgctgaagatgccaagtggcgagtgcgg
ctggccatcattgaatacatgcctctgctggctggacagctcggtgtggaattttttgat
gagaaacttaactctttgtgtatggcctggctagtggatcatgtctatgctatccgtgag
gctgccaccagcaaccttaagaagctagtggagaagttcgggaaggagtgggcccatgcc
actatcatccccaaggtcttagccatgtctggagaccctaactacctgcaccgaatgact
acactcttctgcatcaatgtgttgtctgaggtctgtgggcaggatattaccacgaagcac
atgctgcccacagttcttcgtatggctggggacccagtcgccaatgtccgcttcaatgtg
gccaagtcactacagaagataggacccattcttgataacagcaccctgcaaagtgaagtc
aagcctatcctagagaagctgacccaggaccaggatgtggatgtcaagtactttgcccag
gaggctctgactgttctctctcttgcctga

KEGG   Rattus norvegicus (rat): 246255
Entry
246255            CDS       T01003                                 

Gene name
Ppp2r2d
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03015  mRNA surveillance pathway
rno04071  Sphingolipid signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04390  Hippo signaling pathway
rno04530  Tight junction
rno04728  Dopaminergic synapse
rno05142  Chagas disease
rno05160  Hepatitis C
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    246255 (Ppp2r2d)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    246255 (Ppp2r2d)
   04071 Sphingolipid signaling pathway
    246255 (Ppp2r2d)
   04151 PI3K-Akt signaling pathway
    246255 (Ppp2r2d)
   04152 AMPK signaling pathway
    246255 (Ppp2r2d)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    246255 (Ppp2r2d)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    246255 (Ppp2r2d)
  09156 Nervous system
   04728 Dopaminergic synapse
    246255 (Ppp2r2d)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    246255 (Ppp2r2d)
   05165 Human papillomavirus infection
    246255 (Ppp2r2d)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    246255 (Ppp2r2d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    246255 (Ppp2r2d)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    246255 (Ppp2r2d)
   03036 Chromosome and associated proteins [BR:rno03036]
    246255 (Ppp2r2d)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     246255 (Ppp2r2d)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     246255 (Ppp2r2d)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     246255 (Ppp2r2d)
SSDB
Motif
Pfam: Y_phosphatase2
Other DBs
NCBI-GeneID: 246255
NCBI-ProteinID: NP_653347
RGD: 708356
Ensembl: ENSRNOG00000016940
UniProt: P56932 A0A0G2JSQ0
Position
1
AA seq 453 aa
MAGAGGGGCPTGGNDFQWCFSQVKGAVDEDVAEADIISTVEFNYSGDLLATGDKGGRVVI
FQREQENKGRAHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAHFLLST
NDKTIKLWKISERDKRAEGYNLKDEDGRLRDPFRITALRVPILKPMDLMVEASPRRIFAN
AHTYHINSISVNSDHETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEF
HPHQCNVFVYSSSKGTIRLCDMRSSALCDRHAKFFEEPEDPSSRSFFSEIISSISDVKFS
HSGRYMMTRDYLSVKVWDLNMEGRPVETHQVHEYLRSKLCSLYENDCIFDKFECCWNGSD
SAIMTGSYNNFFRMFDRNTRRDVTLEASRENSKPRASLKPRKVCSGGKRKKDEISVDSLD
FNKKILHTAWHPMESIIAVAATNNLYIFQDKIN
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggcaggagccggaggtggcggctgcccgacgggcggcaacgacttccagtggtgcttc
tcgcaggtgaagggcgctgtcgacgaggacgtggcggaagccgacatcatctccaccgtt
gagtttaactactctggagaccttcttgcaacaggagacaaaggtggcagagttgttatt
ttccaacgggaacaagagaataaaggccgcgctcactctaggggagagtacaatgtttac
agtacctttcagagtcatgagccagagtttgactatttgaaaagtctagaaattgaagaa
aaaattaataaaatcaggtggttaccgcaacagaatgctgctcattttctactctctaca
aatgataaaactattaaattatggaaaataagtgaacgagataaaagagcagaaggttat
aacttgaaagatgaagatggacgacttcgagacccatttagaattacggcactacgggtt
ccaatattgaagcccatggaccttatggtagaagcaagtccacgacgaatttttgcaaat
gctcatacatatcacataaattccatttcagtaaatagtgatcatgaaacatatctctct
gcagatgatctgagaattaacctatggcatttagaaatcacagatagaagcttcaacatt
gtggacatcaagcctgctaacatggaggagctgacagaagtcatcactgccgcggagttc
cacccacaccagtgcaatgtattcgtctacagcagcagcaaggggaccatcaggctgtgt
gacatgcgttcttctgccctctgtgataggcatgccaagttttttgaagagccagaagat
cccagcagtagatcctttttctcagaaataatctcatctatatctgatgtcaagttcagc
cacagtggtcgatacatgatgaccagagactatctgtcggtgaaggtatgggacctcaac
atggagggcaggcctgtcgagacccaccaggtacatgagtacctacgaagcaagctctgc
tccttgtatgagaatgactgcatctttgacaagttcgagtgctgctggaatggttcagac
agtgccattatgacggggtcctacaacaacttctttagaatgtttgatagaaacactcgg
agggatgttacactggaagcctcaagagagaacagcaagccccgagccagcctgaagccc
cggaaagtgtgttcagggggtaagaggaagaaggatgagattagcgtggacagtttggac
ttcaataagaagatccttcacacagcctggcaccccatggagagcattattgctgtagct
gccaccaataacttgtatatattccaggacaaaattaattaa

KEGG   Rattus norvegicus (rat): 24672
Entry
24672             CDS       T01003                                 

Gene name
Ppp2ca
Definition
(RefSeq) serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03015  mRNA surveillance pathway
rno04071  Sphingolipid signaling pathway
rno04114  Oocyte meiosis
rno04136  Autophagy - other
rno04140  Autophagy - animal
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04350  TGF-beta signaling pathway
rno04390  Hippo signaling pathway
rno04530  Tight junction
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno05142  Chagas disease
rno05160  Hepatitis C
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    24672 (Ppp2ca)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    24672 (Ppp2ca)
   04390 Hippo signaling pathway
    24672 (Ppp2ca)
   04071 Sphingolipid signaling pathway
    24672 (Ppp2ca)
   04151 PI3K-Akt signaling pathway
    24672 (Ppp2ca)
   04152 AMPK signaling pathway
    24672 (Ppp2ca)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    24672 (Ppp2ca)
   04136 Autophagy - other
    24672 (Ppp2ca)
  09143 Cell growth and death
   04114 Oocyte meiosis
    24672 (Ppp2ca)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    24672 (Ppp2ca)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    24672 (Ppp2ca)
  09156 Nervous system
   04728 Dopaminergic synapse
    24672 (Ppp2ca)
   04730 Long-term depression
    24672 (Ppp2ca)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    24672 (Ppp2ca)
   05165 Human papillomavirus infection
    24672 (Ppp2ca)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    24672 (Ppp2ca)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    24672 (Ppp2ca)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    24672 (Ppp2ca)
   04131 Membrane trafficking [BR:rno04131]
    24672 (Ppp2ca)
   03036 Chromosome and associated proteins [BR:rno03036]
    24672 (Ppp2ca)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24672 (Ppp2ca)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     24672 (Ppp2ca)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     24672 (Ppp2ca)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     24672 (Ppp2ca)
Membrane trafficking [BR:rno04131]
 Autophagy
  Other autophagy associated proteins
   Others
    24672 (Ppp2ca)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     24672 (Ppp2ca)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   24672 (Ppp2ca)
SSDB
Motif
Pfam: Metallophos STPPase_N Glyco_hydro_65N YqzH
Other DBs
NCBI-GeneID: 24672
NCBI-ProteinID: NP_058735
RGD: 3380
Ensembl: ENSRNOG00000005389 ENSRNOG00000056485
UniProt: P63331
Position
10
AA seq 309 aa
MDEKLFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgagaagttgttcaccaaggagctggaccagtggatcgagcagctgaacgagtgc
aagcagctctccgagtcccaggtcaagagcctctgcgagaaggctaaagaaatcctgaca
aaagaatctaatgttcaggaggttcgatgtccagtcactgtgtgtggagatgtgcatggg
caatttcatgacctcatggaactctttagaattggtggtaaatcaccagatacaaattac
ttgtttatgggagactatgtggacagaggatattactcagttgaaacagttacactgctt
gtagctcttaaggttcgttaccgagagcgtatcaccatactccgagggaatcacgagagc
agacagatcacacaagtttatggtttctacgatgagtgtttaaggaaatacggaaatgca
aatgtttggaaatacttcacagacctttttgactaccttcctctcactgccttggtggat
gggcagatcttctgtctacatggtggtctttcaccatccatagacacactggatcacatc
cgagcacttgatcgcctacaagaagttcctcatgagggtccaatgtgtgacttgctgtgg
tcagatccagatgaccgtggtggctgggggatatctcctcggggagctggttataccttt
ggccaagatatttctgagacatttaatcatgccaatggcctcacgttggtgtccagagct
caccagctggtgatggagggatataactggtgccatgaccggaatgtagtaacaattttc
agtgctccaaactattgctatcgttgtggtaaccaagctgcaatcatggaacttgatgac
actcttaagtattctttcttgcagttcgatccagcacctcgtagaggcgagccacatgtc
actcgtcgtaccccagactacttcctgtaa

KEGG   Rattus norvegicus (rat): 24673
Entry
24673             CDS       T01003                                 

Gene name
Ppp2cb
Definition
(RefSeq) serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03015  mRNA surveillance pathway
rno04071  Sphingolipid signaling pathway
rno04114  Oocyte meiosis
rno04136  Autophagy - other
rno04140  Autophagy - animal
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04350  TGF-beta signaling pathway
rno04390  Hippo signaling pathway
rno04530  Tight junction
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno05142  Chagas disease
rno05160  Hepatitis C
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    24673 (Ppp2cb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    24673 (Ppp2cb)
   04390 Hippo signaling pathway
    24673 (Ppp2cb)
   04071 Sphingolipid signaling pathway
    24673 (Ppp2cb)
   04151 PI3K-Akt signaling pathway
    24673 (Ppp2cb)
   04152 AMPK signaling pathway
    24673 (Ppp2cb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    24673 (Ppp2cb)
   04136 Autophagy - other
    24673 (Ppp2cb)
  09143 Cell growth and death
   04114 Oocyte meiosis
    24673 (Ppp2cb)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    24673 (Ppp2cb)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    24673 (Ppp2cb)
  09156 Nervous system
   04728 Dopaminergic synapse
    24673 (Ppp2cb)
   04730 Long-term depression
    24673 (Ppp2cb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    24673 (Ppp2cb)
   05165 Human papillomavirus infection
    24673 (Ppp2cb)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    24673 (Ppp2cb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    24673 (Ppp2cb)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    24673 (Ppp2cb)
   04131 Membrane trafficking [BR:rno04131]
    24673 (Ppp2cb)
   03036 Chromosome and associated proteins [BR:rno03036]
    24673 (Ppp2cb)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24673 (Ppp2cb)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     24673 (Ppp2cb)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     24673 (Ppp2cb)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     24673 (Ppp2cb)
Membrane trafficking [BR:rno04131]
 Autophagy
  Other autophagy associated proteins
   Others
    24673 (Ppp2cb)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     24673 (Ppp2cb)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   24673 (Ppp2cb)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 24673
NCBI-ProteinID: NP_058736
RGD: 3381
Ensembl: ENSRNOG00000015182
UniProt: P62716
Position
16
AA seq 309 aa
MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgacaaggcgttcaccaaggagctggaccagtgggtggagcagctgaacgagtgt
aagcagctgaacgagaaccaagtgcggacgctgtgcgagaaggctaaggaaattttaaca
aaagaatcaaatgtacaagaggttcgctgtcctgttaccgtctgtggagatgtgcatggc
caattccatgaccttatggaactcttcagaattggtggaaaatcaccagacaccaactat
ctattcatgggtgactatgtagacagaggatattattctgtggagaccgtgactcttctt
gtagcattaaaggtgcgctatccagagcgtatcacaatattgcgaggaaatcatgaaagc
cggcagatcacacaagtatatggcttttatgatgaatgcctacgaaagtatgggaacgcc
aacgtgtggaaatactttacagatctctttgattatcttccacttacagctttagtagat
ggacagatattctgcctccacggtggcctctctccatccatagatacactggatcacata
agagccctggatcgcttacaggaagttccacatgagggcccaatgtgtgatctcttatgg
tcagatccagatgaccgtggtggctggggcatttctccacgtggtgctggctacacattt
ggacaagacatttctgaaacatttaaccatgccaacggcctcacactggtgtcccgtgct
caccagcttgtaatggaaggatataattggtgccatgatcggaatgtggtcaccattttt
agtgcacccaattactgctaccgctgtgggaaccaggctgctatcatggaattagacgac
actttaaaatactcttttcttcagtttgacccagcacctcgtcgtggagagcctcatgtg
acccggcgcaccccagactacttcctataa

KEGG   Rattus norvegicus (rat): 299147
Entry
299147            CDS       T01003                                 

Gene name
Ppp2r5e
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03015  mRNA surveillance pathway
rno04071  Sphingolipid signaling pathway
rno04114  Oocyte meiosis
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04728  Dopaminergic synapse
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    299147 (Ppp2r5e)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    299147 (Ppp2r5e)
   04151 PI3K-Akt signaling pathway
    299147 (Ppp2r5e)
   04152 AMPK signaling pathway
    299147 (Ppp2r5e)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    299147 (Ppp2r5e)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    299147 (Ppp2r5e)
  09156 Nervous system
   04728 Dopaminergic synapse
    299147 (Ppp2r5e)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    299147 (Ppp2r5e)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    299147 (Ppp2r5e)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    299147 (Ppp2r5e)
   03036 Chromosome and associated proteins [BR:rno03036]
    299147 (Ppp2r5e)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     299147 (Ppp2r5e)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     299147 (Ppp2r5e)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     299147 (Ppp2r5e)
SSDB
Motif
Pfam: B56 SBF2
Other DBs
NCBI-GeneID: 299147
NCBI-ProteinID: NP_001100210
RGD: 1305657
Ensembl: ENSRNOG00000005045
UniProt: D3ZHI9
Position
6
AA seq 429 aa
MSSAPTTPPSVDKVDGFSRKSVRKARQKRSQSSSQFRSQGKPIELTPLPLLKDVPTSEQP
ELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCLTEQTYPEVVRMVS
CNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQPSIAKKYIDQKF
VLQLLELFDSEDPRERDYLKTVLHRIYGKFLGLRAFIRKQINNIFLSIINGFALPLKAEH
KQFLVKVLIPLHTVRSLSLFHAQVIRGLMKFWPKTCSQKEVMFLGELEEILDVIEPSQFV
KIQEPLFKQIAKCVSSPHFQVAERALYYWNNEYIMSLIEENSNVILPIMFSSLYRISKEH
WNPAIVALVYNVLKAFMEMNSTMFDELTATYKSDRQREKKKEKEREELWKKLEDLELKRG
LRRDGIIPT
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgtcctcagcaccaactactcctccatcagtggataaagtagacggattttctcggaag
tccgtcagaaaagccagacagaagaggtcgcaaagctcctcacagtttcggtctcaaggc
aagcccattgagctcacacctctgccactgctgaaagacgttccaacctcagagcagcct
gaactgttcctaaagaaacttcagcagtgctgtgtcatttttgacttcatggacacgcta
tctgatcttaaaatgaaagaatacaagcgctccactcttaatgaactggtggactacatt
acaataagcagaggctgtctgacagagcagacttaccctgaagtagttagaatggtgtct
tgcaatatattcagaactctccctcctagtgacagcaatgaattcgacccagaagaagat
gaacctaccctcgaggcatcatggccccacctacagcttgtatatgaatttttcatacga
tttttggaaagccaagaattccaacccagcattgccaaaaaatacatagatcagaaattt
gtattacagcttttggagctattcgacagtgaagaccctcgagaacgggactatttaaaa
acagtcttgcacaggatttatggcaagtttctcgggcttagagcatttatccgaaaacaa
attaacaatatttttctaagtattatcaatggcttcgctttaccacttaaggcagaacac
aaacagttcctggtgaaagtgttgatccctttgcacactgtccggagtttatcactcttc
catgcccaggttattagggggttaatgaaattttggcctaaaacatgcagtcaaaaagag
gtcatgttccttggggagctggaagaaatcttggatgtgattgaaccatcacaatttgtt
aaaatccaagaacctttgtttaaacaaattgccaagtgtgtttctagcccccattttcag
gtggcagaaagggcactctattattggaataatgagtacatcatgagtttgatagaagaa
aactcgaacgtcatccttcccatcatgttctccagcctttataggatttcaaaggagcat
tggaatccggctattgtggcgctggtgtacaacgtgttgaaagcatttatggaaatgaac
agcactatgtttgatgagctgacagccacatacaagtcagatcgtcagcgtgagaaaaag
aaagaaaaggagcgtgaagaactgtggaaaaaattggaggatctggagttaaaaagaggt
cttagacgcgatgggataattccgacttaa

KEGG   Rattus norvegicus (rat): 309179
Entry
309179            CDS       T01003                                 

Gene name
Ppp2r5b
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03015  mRNA surveillance pathway
rno04071  Sphingolipid signaling pathway
rno04114  Oocyte meiosis
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04728  Dopaminergic synapse
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    309179 (Ppp2r5b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    309179 (Ppp2r5b)
   04151 PI3K-Akt signaling pathway
    309179 (Ppp2r5b)
   04152 AMPK signaling pathway
    309179 (Ppp2r5b)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    309179 (Ppp2r5b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    309179 (Ppp2r5b)
  09156 Nervous system
   04728 Dopaminergic synapse
    309179 (Ppp2r5b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    309179 (Ppp2r5b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    309179 (Ppp2r5b)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    309179 (Ppp2r5b)
   03036 Chromosome and associated proteins [BR:rno03036]
    309179 (Ppp2r5b)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     309179 (Ppp2r5b)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     309179 (Ppp2r5b)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     309179 (Ppp2r5b)
SSDB
Motif
Pfam: B56 FTCD_C
Other DBs
NCBI-GeneID: 309179
NCBI-ProteinID: NP_852044
RGD: 727786
Ensembl: ENSRNOG00000021025
UniProt: Q80W83
Position
1
AA seq 497 aa
METKLPPASTPTSPSSPGLSPVPPPDKVDGFSRRSLRRARPRRSHSSSQFRYQSNQQELT
PLPLLKDVPASELHELLSRKLAQCGVMFDFLDCVADLKGKEVKRAALNELVECVGSTRGV
LIEPVYPDIIRMISVNIFRTLPPSENPEFDPEEDEPNLEPSWPHLQLVYEFFLRFLESPD
FQPSVAKRYVDQKFVLMLLELFDSEDPREREYLKTILHRVYGKFLGLRAYIRKQCNHIFL
RFIYELEHFNGVAELLEILGSIINGFALPLKTEHKQFLVRVLIPLHSVKSLSVFHAQLAY
CVVQFLEKDATLTEHVIRGLLKYWPKTCTQKEVMFLGEMEEILDVIEPSQFVKIQEPLFK
QVARCVSSPHFQVAERALYFWNNEYILSLIEDNCHTVLPAVFGTLYQVSKEHWNQTIVSL
IYNVLKTFMEMNGKLFDELTASYKLEKQQEQQKAQERQELWRGLEELRLRRLQGTQGAKE
APVPRPTPQVAASGGQS
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggagacgaagctgccccctgcaagcacccccacaagcccctcctccccggggctgtct
ccagtgccaccaccagacaaggtggatggcttctcccgccgatccctccgcagggcccgg
ccccgacgctcacacagctcttctcagttccgctatcagagcaaccagcaagagctcact
ccactgcccctgctcaaagatgtgccagcctctgagttacatgagttgctaagccggaaa
ctggcccaatgtggggtgatgtttgacttcttggactgtgtggctgacctcaagggcaag
gaggtgaagcgtgcagccctcaatgaacttgtggaatgtgtggggagcacccggggggtc
ctcattgagcctgtctacccagacatcatccgcatgatatcagtaaatatcttccggacc
ctgccgcccagtgagaaccctgaatttgaccctgaagaagatgagcccaaccttgagcct
tcgtggccacatctacagctggtatatgagtttttcctgcggttcttggagagtccagat
ttccagccctctgtggccaagagatacgtggatcaaaagtttgttctgatgctcctggag
ctatttgacagcgaggacccccgggaacgtgagtacctcaagaccatcttgcatcgggta
tacggcaagttcctgggtctccgggcctacatccgcaaacagtgcaaccacatcttcctc
cggttcatctatgagctggagcactttaatggtgtggctgagctgttagagatcttagga
agcatcatcaatggctttgcgctgcccctgaagactgagcacaaacagttcctggttcga
gtcctcatccccttgcactctgtcaagtcactgtctgtttttcatgctcagctggcatac
tgtgtggtgcagttcctggagaaggatgcgaccttgacagagcatgttatccgggggctt
ctcaaatactggcctaaaacctgcacccagaaggaggtgatgttcctgggggagatggaa
gagattctcgatgtgatcgagccctcccagtttgtgaagatccaggagcctctcttcaag
caggtggctcgctgtgtctccagcccccatttccaggttgcagagcgggctctgtatttc
tggaacaatgagtacatcctgagcctcattgaggacaactgccacactgtgctgcctgcg
gtatttgggaccctctaccaagtgtccaaggagcactggaatcaaaccatcgtgtccctg
atctacaacgtgctcaagactttcatggagatgaatgggaagctgtttgatgagcttaca
gcctcctacaagctagaaaaacagcaggagcagcagaaggcccaggagcggcaggaactt
tggcgaggcttggaggaactgcggttacgccggctacaggggacccaaggggccaaggaa
gcccctgtcccaaggcctacgccccaggtggctgccagtgggggtcaaagctag

KEGG   Rattus norvegicus (rat): 312754
Entry
312754            CDS       T01003                                 

Gene name
Ppp2r5a
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03015  mRNA surveillance pathway
rno04071  Sphingolipid signaling pathway
rno04114  Oocyte meiosis
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04728  Dopaminergic synapse
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    312754 (Ppp2r5a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    312754 (Ppp2r5a)
   04151 PI3K-Akt signaling pathway
    312754 (Ppp2r5a)
   04152 AMPK signaling pathway
    312754 (Ppp2r5a)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    312754 (Ppp2r5a)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    312754 (Ppp2r5a)
  09156 Nervous system
   04728 Dopaminergic synapse
    312754 (Ppp2r5a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    312754 (Ppp2r5a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    312754 (Ppp2r5a)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    312754 (Ppp2r5a)
   03036 Chromosome and associated proteins [BR:rno03036]
    312754 (Ppp2r5a)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     312754 (Ppp2r5a)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     312754 (Ppp2r5a)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     312754 (Ppp2r5a)
SSDB
Motif
Pfam: B56
Other DBs
NCBI-GeneID: 312754
NCBI-ProteinID: NP_001101361
RGD: 1308022
Ensembl: ENSRNOG00000000068
UniProt: D3ZDI7
Position
13
AA seq 486 aa
MSSPSPPAPVACAAISASEKVDGFTRKSVRKAQRQKRSQGSSQFRSQGSQAELHPLPQLK
DATSNEQQELFCQKLQQCCVLFDFMDSVSDLKSKEIKRATLNELVEYVSTNRGVIVESAY
SDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASWPHIQLVYEFFLRFLESPDFQPSIA
KRYIDQKFVQQLLELFDSEDPRERDFLKTVLHRIYGKFLGMRAFIRKQTNNIFLRFIYET
EHFNGVAELLEILGSIINGFALPLKAEHKQFLMKVLIPMHTAKGLALFHAQLAYCVVQFL
EKDTTLTEPVIRGLLKFWPKTCSQKEVMFLGEIEEILDVIEPTQFKKIEEPLFKQISKCV
SSSHFQVAERALYFWNNEYILSLIEENIDKILPIMFASLYKISKEHWNQTIVALVYNVLK
TLMEMNGKLFDDLTSSYKAERQREKKKELEREELWKKLEELKLKKALEKQNNAYNMHSIL
SNTSAQ
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgtcgtcgccgtcgccgcccgcaccagttgcctgcgccgccatctcggcctcggagaaa
gtggacggcttcacccggaaatcggtgcgcaaggcgcagaggcagaagcgctctcagggc
tcgtcgcagttccgcagccagggcagccaggcggagctgcaccccctgccccagctcaaa
gatgctacatcaaatgaacagcaagagcttttctgccagaagctacaacagtgctgtgta
ctgtttgatttcatggactctgtttcagacttgaagagcaaagaaattaaaagagcaacg
ctcaatgagctggttgagtatgtttcgactaaccgtggtgtaattgttgaatcagcgtat
tctgatattgtaaaaatgatcagtgctaacatcttccggacacttcctccaagtgataac
ccagactttgacccggaagaggatgagcccacacttgaggcctcttggcctcacatacag
ctggtgtatgaattcttcttgagattcttggagagtcctgatttccagcccagcattgca
aagcgatacattgaccagaagtttgtacaacagctcctggagcttttcgacagtgaagac
ccacgagagcgtgacttcctgaagaccgtcctgcaccggatttacgggaagttcctggga
atgagggcgttcatcagaaagcaaaccaacaacatcttcctcaggtttatctatgaaacg
gagcatttcaatggagtggctgagctccttgaaatactgggaagtatcatcaatggcttt
gcgttgccactgaaagcagaacataagcagtttctaatgaaggttcttattcctatgcat
actgcaaaaggactggctctgtttcatgctcagctggcctactgtgttgtgcagttcctg
gagaaagacacgacactgacagagccggtgatcagaggactcctgaaattttggccaaaa
acatgcagtcagaaagaggtgatgtttttaggagaaattgaagagatcttagacgtcatt
gagccaacacaattcaaaaagattgaagagccgctttttaaacagatatccaagtgtgtc
tccagttctcacttccaggttgcagagagagcactgtacttctggaataacgaatacatt
ctcagtttgattgaggagaacatcgataagatcctgcccatcatgtttgccagtttgtat
aaaatttccaaagaacactggaatcagactattgtagctctggtatacaacgtgctgaaa
accctaatggagatgaacgggaagctttttgatgaccttactagttcctacaaggctgaa
agacagagagagaagaagaaagaactggaacgcgaagaattatggaaaaagttagaagag
ttgaagctgaagaaggctctagagaaacagaacaatgcttacaacatgcacagtattctc
agcaataccagtgcccagtaa

KEGG   Rattus norvegicus (rat): 315648
Entry
315648            CDS       T01003                                 

Gene name
Ppp2r1b
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03015  mRNA surveillance pathway
rno04071  Sphingolipid signaling pathway
rno04114  Oocyte meiosis
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04350  TGF-beta signaling pathway
rno04390  Hippo signaling pathway
rno04530  Tight junction
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno05142  Chagas disease
rno05160  Hepatitis C
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    315648 (Ppp2r1b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    315648 (Ppp2r1b)
   04390 Hippo signaling pathway
    315648 (Ppp2r1b)
   04071 Sphingolipid signaling pathway
    315648 (Ppp2r1b)
   04151 PI3K-Akt signaling pathway
    315648 (Ppp2r1b)
   04152 AMPK signaling pathway
    315648 (Ppp2r1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    315648 (Ppp2r1b)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    315648 (Ppp2r1b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    315648 (Ppp2r1b)
  09156 Nervous system
   04728 Dopaminergic synapse
    315648 (Ppp2r1b)
   04730 Long-term depression
    315648 (Ppp2r1b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    315648 (Ppp2r1b)
   05165 Human papillomavirus infection
    315648 (Ppp2r1b)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    315648 (Ppp2r1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    315648 (Ppp2r1b)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    315648 (Ppp2r1b)
   03036 Chromosome and associated proteins [BR:rno03036]
    315648 (Ppp2r1b)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     315648 (Ppp2r1b)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     315648 (Ppp2r1b)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     315648 (Ppp2r1b)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Adaptin_N Cnd1 CLASP_N M11L AEP1
Other DBs
NCBI-GeneID: 315648
NCBI-ProteinID: NP_001020589
RGD: 1304764
Ensembl: ENSRNOG00000010922
UniProt: Q4QQT4
Position
8
AA seq 601 aa
MAGAAGPGTVPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTR
TELLPFLTDTIYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPLESLATVEETVVRDKA
VESLRQISQEHTPVALEAHFVPLVKRLASGDWFTSRTSACGLFSVCYPRASNAVKAEIRQ
HFRSLCSDDTPMVRRAAASKLGEFAKVLELDSVKTEIVPLFTNLASDEQDSVRLLAVEAC
VSIAQLLSQDDLEALVMPTLRQAAEDKSWRVRYMVADKFSELQKAVGPKIALSDLIPAFQ
SLLRDCEAEVRAAAAHKVRELCENLPTEGRETVIMNQILPYIKELVSDTNQHVKSALASV
IMGLSTVLGKENTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAI
VELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLMK
LVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGKEITTKQMLPIVLKM
AGDQVANVRFNVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAISVLAL
A
NT seq 1806 nt   +upstreamnt  +downstreamnt
atggcgggcgcagcagggccagggaccgttccgggggcagcgggcggagatggagacgat
tcactctacccgatcgcggttttaatcgacgagctccgcaatgaggacgtgcagctccgt
ctcaacagtattaagaagttatcaactattgctctagcactcggggtagaaaggactcga
actgaactgctgcctttccttacagatacaatttatgatgaagatgaggtgctgttagct
cttgccgagcagctggggaatttcactggtttggtgggaggccctgactttgcccactgt
ctgctgcctcctttggaaagtttggctacggtggaggagactgtcgttcgagacaaggct
gtggagtccctgaggcagatctcccaggagcacactcccgttgccctggaagctcatttt
gtacccctggtgaagcgcttagcaagtggggattggttcacatctcgcacatctgcatgc
ggtttgttcagcgtttgctaccccagagcttcaaatgctgtcaaggcagagatccgacag
cacttccgttccctgtgctcggatgatacaccaatggtgcgacgtgctgctgcttccaaa
ttgggtgaatttgcaaaagttttggaattagacagtgttaaaactgaaattgttccatta
ttcacgaatctggcttcagatgaacaggattctgtgcgcctgctagctgtagaagcgtgt
gtcagtattgcccagctactgtctcaggatgacctggaagccttggtaatgcctacactt
cggcaagcagcagaagataaatcttggcgggttcgctacatggtggctgacaaattttca
gagctccagaaagcggtgggccctaaaattgcactcagtgacctcatccccgccttccag
agcctcctcagagactgcgaggccgaagtccgagcagccgctgcccacaaagtaagagag
ctttgtgagaacctgcccactgaaggcagagagaccgtgattatgaaccaaatcctgccc
tatataaaggaattagtgtctgataccaaccaacatgtcaagtcagccctagcttctgta
attatgggattatctacagttttgggcaaagagaataccattgaacatcttctgcctcta
tttttagctcaattaaaggatgagtgtccagaagttcgtttaaatatcatctccaatttg
gattgtgtgaatgaagtgattggaatccgtcagctctctcagtctctcctccctgccatt
gtggaactggctgaggacgccaagtggagggtccgcttggcgatcattgagtacatgccg
ctgctggctggccagctgggtgtggagttttttgatgaaaagctgaattctttgtgtatg
gcctggcttgtggatcatgtctatgccattcgggaagcagcaaccaacaacctcatgaag
ttagtccagaagtttggtaccgagtgggcccagaacaccatcgtccccaaagtgttggta
atggcaaatgatccgaactacttgcacaggatgaccaccttattctgcattaatgccctc
tctgaagcctgtggtaaggaaataaccactaagcaaatgttgcctatcgtgttgaaaatg
gctggagaccaggtggcaaatgtccgcttcaatgtggctaagtcactgcagaagattgga
cccattctagacaccaacgccttgcagggggaagtgaagccggtgctgcagaaattaggt
caggatgaagacatggatgtcaaatattttgcacaggaagctataagtgttcttgccttg
gcataa

KEGG   Rattus norvegicus (rat): 362739
Entry
362739            CDS       T01003                                 

Gene name
Ppp2r3c
Definition
(RefSeq) serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma
  KO
K11583  serine/threonine-protein phosphatase 2A regulatory subunit B''
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03015  mRNA surveillance pathway
rno04071  Sphingolipid signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04728  Dopaminergic synapse
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    362739 (Ppp2r3c)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    362739 (Ppp2r3c)
   04151 PI3K-Akt signaling pathway
    362739 (Ppp2r3c)
   04152 AMPK signaling pathway
    362739 (Ppp2r3c)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    362739 (Ppp2r3c)
  09156 Nervous system
   04728 Dopaminergic synapse
    362739 (Ppp2r3c)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    362739 (Ppp2r3c)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    362739 (Ppp2r3c)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    362739 (Ppp2r3c)
   03036 Chromosome and associated proteins [BR:rno03036]
    362739 (Ppp2r3c)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     362739 (Ppp2r3c)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     362739 (Ppp2r3c)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     362739 (Ppp2r3c)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_13 EF-hand_1 EF-hand_5 DUF61
Other DBs
NCBI-GeneID: 362739
NCBI-ProteinID: NP_001014218
RGD: 1309207
Ensembl: ENSRNOG00000023591
UniProt: Q6AXZ3
Position
6
AA seq 453 aa
MDWKDVLRRRLASPNSDPKRKKSEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFY
YRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQIPPMIGEEAMINY
ENFLKVGEKAGPKCKQFFTAKVFAKLLHTDSYGRVSIMQFFNYVMRKVWLHQTRIGLSLY
DVAGQGYLRESDLENYILELIPTLPQLDGLEKSFYSFYVCTAVRKFFFFLDPLRTGKIKI
QDILACSFLDDLLELRDEELSKESQETNWFSAPSALRVYGQYLNLDKDHNGMLSKEELSR
YGTATMTNVFLDRVFQECLTYDGEMDYKTYLDFVLALENRKEPAALQYIFKLLDIENKGY
LNVFSLNYFFRAIQELMKIHGQDPVSFQDVKDEIFDMVKPKDPLKISLQDLINSNQGDTV
TTILIDLNGFWTYENREALVANDNENSADLDDT
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggactggaaagacgtgcttcgtcggcggttagcgtcgcccaactcggatccaaagagg
aaaaaaagcgaacaagaattaaaagatgaagaaatggatttgtttaccaaatactactca
gaatggaaaggaggtagaaaaaacacaaatgaattctataagaccattccccggttttat
tacaggttgccagctgaagatgaagtcttactacagaaattaagagaggaatctagagct
gtctttctacagaggaaaagcagagaactcttagataatgaagaattacagaacttatgg
tttttgttggataaacaccagataccacctatgattggagaggaagcaatgatcaattat
gaaaattttttgaaggttggtgaaaaggctggaccaaagtgcaagcaattttttactgca
aaagtctttgccaaactcctccatacagattcatatgggagagtttccatcatgcaattc
tttaactacgtcatgcgaaaagtttggctacatcagacaagaataggactcagtttatat
gatgttgctggacaaggataccttcgggaatcggacttagagaactacatcctggagctc
atccccaccttgccacagttagatggcttggaaaaatccttttactccttctatgtttgt
acagcagttaggaagttcttcttcttcttggaccctctaaggacagggaaaatcaaaatt
caagatattttagcatgcagcttcctggatgatttactggagctaagagatgaggaattg
tccaaagaaagtcaagaaacgaattggttttctgctccttctgccctgagggtctatggt
cagtatttgaatcttgataaagatcataatggcatgctaagtaaagaagagctctccaga
tacggaacagccaccatgaccaatgtcttcctagaccgagttttccaggagtgtctcact
tacgatggagagatggactataagacctacctggactttgttctcgccttagaaaacaga
aaggagcccgcggctctgcagtatattttcaaactgctggacatcgagaacaaggggtac
ctgaatgtcttttcccttaattatttctttagggccatacaagaactaatgaaaatccat
ggacaggatcctgtttcatttcaagatgtcaaggatgaaatctttgacatggtcaaacct
aaggatcctttgaaaatctcacttcaggatttaatcaatagtaatcaaggagacacagtc
actaccattctaattgatctcaatggcttctggacctatgaaaacagagaagcccttgtt
gcaaatgacaacgagaactctgcagatcttgatgatacctga

KEGG   Rattus norvegicus (rat): 363122
Entry
363122            CDS       T01003                                 

Gene name
Ppp2r3a
Definition
(RefSeq) serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha
  KO
K11583  serine/threonine-protein phosphatase 2A regulatory subunit B''
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03015  mRNA surveillance pathway
rno04071  Sphingolipid signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04728  Dopaminergic synapse
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    363122 (Ppp2r3a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    363122 (Ppp2r3a)
   04151 PI3K-Akt signaling pathway
    363122 (Ppp2r3a)
   04152 AMPK signaling pathway
    363122 (Ppp2r3a)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    363122 (Ppp2r3a)
  09156 Nervous system
   04728 Dopaminergic synapse
    363122 (Ppp2r3a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    363122 (Ppp2r3a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    363122 (Ppp2r3a)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    363122 (Ppp2r3a)
   03036 Chromosome and associated proteins [BR:rno03036]
    363122 (Ppp2r3a)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     363122 (Ppp2r3a)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     363122 (Ppp2r3a)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     363122 (Ppp2r3a)
SSDB
Motif
Pfam: EF-hand_13 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6
Other DBs
NCBI-GeneID: 363122
NCBI-ProteinID: NP_001012202
RGD: 1306958
Ensembl: ENSRNOG00000022999
UniProt: D3ZLD7
Position
8
AA seq 1150 aa
MAATYRLVVSTVNHYSSVVIDRRFEQAIHYCTGTCHTFTHGIDCIVVHHSVCADLLHIPV
SQFKDVDLNSVFLSHENGLSSAEDYPHQALTGIPRSKRASTFQNTCNLKDIAGEAISFAS
GKIKEFSLEKLRNSNHAAYKKGRKVKSDSFNRRSVDLDLLCGHYSNDGTSPSFGLLRSSS
VEEKSLSHRNSLDTSLTSMLFQNLSEEDLVTQILEKHKIDHFSSGTDIKMCLDILLKCSE
DLKKCTDIIKQCIKKKSGGSINEGSGSDAMSNSETVYMNVMARLAYYLRKLPFEFVQSGS
NETVDLTELVNNVPNLQLTPFSPLYGTEQPPKYEDIVHLSALDSRQFQTVELQDDMHNFK
QTDTVKTPPNNTNSLCSLEVNDPGTLKPVQLQSPSLTINHLENVSSGNLMETLYIEEESD
GKKSLLDKGQKADNGQGQEPLKVNEHKEFSDHDTYLKKCPAPVQNEISKIFEKPMVVRPP
KEESELAVPPTELRAQRHFMNPNSQEEIDKLLMDLESFSQKMETSLGEPLAKGKSINSLN
SHSHLTGQIHKDLEPKPIVSSATEKVSPSCLTRIIENNGHKIEEEDRALLLRILESIEDF
AQELVECKSSRGSLSQEKEMMQILQETLTASSQPTPSVSRSPVGEKPKDSTSVVLIQQTP
EVIKIQNKPEKKPATPCPPAATLPSSPQPASPVPCVSDVVNTPLSINIPQFYFPEGLPDT
CSNHEQILGRIEAAFKDIEDQKADIHEMGRIAKACGCPLYWKAPMFRAAGGEKTGFVTAQ
SFMAMWKKLLSDHHDDASRFIWLLAKPSCSHLQQEDFIPLLQDVVDTHPGLTFLKDAPEF
HSRYITTVVQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHFY
VIYCKFWELDGDHDLYISQADLSRYNDQASSNRIIERIFSGAVTRGKTVQREGRMSYADF
VWFLISEEDKRNPTSIEYWFRCMDVDGDGVLSMYELEYFYEEQCERMEAMGIEPLPFHDL
LCQMLDLVKPANDGRITLRDLKRCRMAHIFYDTFFNLEKYLDHEQRDPFAVQKDVENEGP
EPSDWDRFAAEEYEALVTEESAQVQLQEGSFEDYESDEPVSPSELGNKGNKILTSSLSEK
CGKLQSVDEE
NT seq 3453 nt   +upstreamnt  +downstreamnt
atggcagcaacttacagactcgtggttagcactgtgaaccattatagcagtgtagtgata
gaccggcgttttgaacaagccatacattattgcactggaacctgccataccttcacacat
ggaatagactgcattgtagtgcatcatagtgtttgtgcagaccttttgcacatccctgtg
tctcagttcaaagatgtggatctgaactctgtgtttttgtctcatgaaaatggcctttcc
tcagctgaagactatccccatcaggccctcacaggaatacccaggtccaagagagcatcc
acatttcagaatacctgtaacttaaaggacattgcaggagaagcaatcagctttgccagt
gggaaaataaaagaattttcccttgaaaaactcagaaattcaaatcatgcagcttacaaa
aaaggaagaaaagttaaatctgactcatttaataggcgatcagttgatttggatttactc
tgtggccattatagtaacgatgggacctccccatcctttggcttactccggagttcctca
gttgaggaaaaatctttatctcatagaaactcactagatacaagcctaacttccatgctt
tttcagaacttgtctgaagaagatctagttacgcagattttggaaaaacataaaatagat
catttttcttctgggacagacataaaaatgtgcttggacatcttactgaaatgctctgaa
gatttgaaaaaatgtacagacatcataaaacaatgcataaagaaaaagtcaggaggaagc
atcaacgaaggaagtggcagtgacgcaatgtctaactctgaaaccgtctatatgaatgta
atggccaggttagcttactacctgagaaagttaccatttgaatttgtgcagtctgggagt
aatgagactgtagatttgacagagcttgtcaataatgtacctaacttacaactgactcca
ttctccccattatatgggactgaacagccccctaaatatgaagatatcgtccacctctca
gcccttgactccagacagtttcagactgttgaattgcaagatgacatgcataattttaaa
caaacagatactgtaaaaacccctccaaacaacacaaattccttgtgtagcttggaggta
aacgatcctggaactctaaaacctgtgcagcttcaatcaccgtcattaaccataaaccat
ttagagaatgtttcttctggtaacttaatggaaactctttatattgaagaagagtcagat
ggaaagaagtcattattagataaaggacaaaaagcagataatggacaaggtcaggaacca
ttaaaggtaaatgaacataaagaattttcagaccatgatacttatcttaaaaaatgtcct
gccccagtgcaaaatgaaatcagtaagatatttgaaaagccaatggtagttcgtccacct
aaggaagaatctgaattagcagttcctcctacagaactcagagcccagaggcactttatg
aatcctaacagtcaagaagagatcgacaaattgttaatggatttggaatcattctcacag
aagatggagacctctctaggagaaccacttgccaagggtaaaagcatcaattctctaaat
agtcatagtcatttgactggtcagatccacaaagatcttgagcctaaacctatagtctct
tcagctacggagaaagtctcaccttcttgtctaacaaggattattgaaaacaacggacac
aaaatagaggaagaggaccgagccctcttacttcgaattctggaaagcattgaagacttt
gctcaagaactagttgaatgcaagtcaagcagagggagcctatcacaagaaaaggaaatg
atgcaaattctgcaggaaactttgacagcttcctcccagcccactccatcagtcagtagg
agccctgttggtgagaaacccaaagatagtacttcagttgttttgattcaacagacacca
gaagtgatcaagattcaaaataaaccagaaaaaaaacctgcaacaccatgtccacctgca
gccacccttccaagtagtccccagcctgcctcccctgttccttgtgtgagcgatgtcgtg
aatacaccactgtccataaacattccacagttctactttcccgaaggactcccagacacc
tgcagcaaccacgaacagatcctaggcagaattgaagctgctttcaaggatattgaagat
caaaaagcagatattcatgaaatggggagaattgcaaaggcctgcggctgtccactctat
tggaaagcccccatgttcagggctgcaggaggagagaagactggatttgtgacagcacag
tcattcatggccatgtggaaaaagttgctaagtgaccatcatgatgatgcctccaggttc
atctggcttctggcaaagcccagctgcagccatctccaacaagaggattttatccctcta
cttcaggatgtggtagatacacaccctggcctcaccttcctgaaagatgctcctgaattc
cattcccgctacatcaccacggttgttcagagaatattctacacagtcaacagatcttgg
agtggaaaaattacttcaacagagataaggaaaagcaactttttgcaaactctggccctt
ttggaggaagaggaagatataaaccaaatcacagattacttctcttatgaacatttctat
gtcatttattgtaaattctgggaactagatggtgatcatgacctatacatcagccaagct
gatctctctcgatacaatgaccaggcttcatcaaatagaattattgaaagaatattttct
ggagcagtaacaagagggaaaactgtacaaagagagggaagaatgagctatgcagatttt
gtttggtttttgatttctgaggaagacaaacggaaccctaccagcattgagtattggttc
cgctgcatggatgtggatggagatggtgtactttccatgtatgaactagagtatttctat
gaagagcagtgtgaacggatggaagccatgggcatcgagcccttgccgtttcatgatctg
ttgtgccagatgctagacttggtgaagccagctaatgatggcagaataactctgcgagat
ttgaagaggtgcagaatggctcacatcttctacgacactttctttaacctggagaagtac
ttggaccatgaacaaagagatccttttgcagtccagaaggatgttgaaaatgagggcccc
gagccctctgactgggacaggtttgctgctgaggagtacgaggctctggtgactgaggaa
tctgcccaggttcagctccaggaaggctcatttgaagactatgaatcagatgagcctgtg
tctccctctgaacttggaaacaagggcaataaaatcctaacttcaagcctttcagagaaa
tgtggaaagctccagtcagtggatgaagagtag

KEGG   Rattus norvegicus (rat): 363193
Entry
363193            CDS       T01003                                 

Gene name
Ppp2r5d
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform isoform X2
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03015  mRNA surveillance pathway
rno04071  Sphingolipid signaling pathway
rno04114  Oocyte meiosis
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04728  Dopaminergic synapse
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    363193 (Ppp2r5d)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    363193 (Ppp2r5d)
   04151 PI3K-Akt signaling pathway
    363193 (Ppp2r5d)
   04152 AMPK signaling pathway
    363193 (Ppp2r5d)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    363193 (Ppp2r5d)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    363193 (Ppp2r5d)
  09156 Nervous system
   04728 Dopaminergic synapse
    363193 (Ppp2r5d)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    363193 (Ppp2r5d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    363193 (Ppp2r5d)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    363193 (Ppp2r5d)
   03036 Chromosome and associated proteins [BR:rno03036]
    363193 (Ppp2r5d)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     363193 (Ppp2r5d)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     363193 (Ppp2r5d)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     363193 (Ppp2r5d)
SSDB
Motif
Pfam: B56
Other DBs
NCBI-GeneID: 363193
NCBI-ProteinID: XP_001062510
RGD: 1306666
Ensembl: ENSRNOG00000016849
Position
9
AA seq 671 aa
MRKKGSCLAPMTNPRRRRLVVRQVCKSSGQLEAQPPLGPGAARRRWRRDAERAECGRAEP
EPERGRRSRAGCGPAEMPYKLKKDKEPPKLAKGTAKPSSSSKDGGGENTDTEAQPQPQPQ
PPSSNKRPSNSTPPPTQLSKIKYSGGPQIVKKERRQSSSRFNLSKNRELQKLPALKDSPT
QEREELFIQKLRQCCVLFDFVSDPLSDLKFKEVKRAGLNEMVEYITHSRDVVTEAIYPEA
VTMFSVNLFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIA
KKYIDQKFVLALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYET
EHHNGIAELLEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFL
EKESSLTEPVIVGLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCV
SSPHFQVAERALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALK
LFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPV
YSMETETPTAEDIQLLKRTVETEAVQMLKDIKKDKVLLRRKSELPQDVYTIKALEAHKRA
EEFLTASQEAL
NT seq 2016 nt   +upstreamnt  +downstreamnt
atgagaaaaaagggaagctgcttggctccaatgaccaatccgaggaggcggcgcctggtt
gtcaggcaggtttgtaagagttcgggccaattggaagcgcagccaccgctcggcccgggc
gcagcgcgcaggcggtggcgaagagacgccgagcgggccgagtgcggccgagcagagccg
gagccggagcggggccgcaggagccgggccgggtgtggaccggccgagatgccctataaa
ctgaagaaggataaggagccccccaagcttgccaaaggcacagccaagcccagcagctcc
agcaaggatggtggaggggagaacacagacacagaggcgcagccccagccccagcctcag
ccaccatcatccaacaagcgacctagtaacagcacaccacccccaacgcaactcagcaaa
atcaagtactcagggggaccccagattgtcaagaaagaacgacgccaaagctcctcccgc
ttcaacctcagcaagaaccgggagctacagaaacttcctgccttgaaagattcgccaacc
caggaacgtgaggagctgttcatccagaagctacgccagtgctgtgtcctctttgacttc
gtgtcagacccactcagtgacctcaaattcaaagaggtgaagcgggcaggactcaatgag
atggtggagtatatcacccacagccgtgacgttgtcaccgaggccatctaccccgaggct
gtcaccatgttttcagtgaatctcttccggacgctgcctccttcatcgaatcccacagga
gccgagtttgaccctgaggaagatgagcctaccttggaagcggcctggccacatctccag
cttgtgtatgagtttttcttacgtttcttggaatctccagatttccagccgaatatagcc
aagaagtacattgaccagaagtttgtacttgctctcctggaccttttcgatagcgaagac
cctcgagagcgggattttcttaagaccattttgcatcgcatctatggcaagtttttgggg
ctccgggcttatatccgtaggcagatcaaccacatcttctacaggttcatttatgagact
gagcatcacaatggcattgctgagctcctggagatcctcggcagcatcatcaatggcttt
gccttgccccttaaggaagagcacaagatgtttctcatccgcgtcctgcttccacttcac
aaagtcaagtccctgagtgtgtaccaccctcagctggcatactgtgtggtacagttcctg
gagaaagagagcagtctcactgagccggtgattgtgggacttctcaaattttggcctaag
acccacagccccaaggaggtgatgtttctgaatgagctagaggagattctggatgtcatt
gaaccctcggagttcagcaaagtcatggagccgctcttccgccagctcgccaaatgtgtc
tccagcccccatttccaggtggcagagcgtgccctgtactactggaacaatgagtacatc
atgagcctgatcagtgacaatgctgcccgtgtcctccccatcatgtttcctgcgctctac
aggaactccaaaagccactggaacaagacaatccatggactcatctacaatgccctgaag
ctcttcatggagatgaaccagaagctgtttgatgattgtacacaacagtacaaggccgag
aagcagaagggccggttccgaatgaaggagagagaggagatgtggcagaagattgaggag
ctggcccggctcaatccccagtaccctatgtttcgagctcctccaccgctgccccctgtg
tattccatggagacagagacccccacagcagaggacatccagctcctgaaaaggacggtg
gaaacagaagcagtgcagatgctgaaggacatcaagaaggataaagtgctgctccggagg
aagtcagagctgccacaggatgtgtacaccatcaaggcactggaggcacacaagcgggca
gaagagtttctaactgccagccaggaggctctctga

KEGG   Rattus norvegicus (rat): 60660
Entry
60660             CDS       T01003                                 

Gene name
Ppp2r2b
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03015  mRNA surveillance pathway
rno04071  Sphingolipid signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04390  Hippo signaling pathway
rno04530  Tight junction
rno04728  Dopaminergic synapse
rno05142  Chagas disease
rno05160  Hepatitis C
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    60660 (Ppp2r2b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    60660 (Ppp2r2b)
   04071 Sphingolipid signaling pathway
    60660 (Ppp2r2b)
   04151 PI3K-Akt signaling pathway
    60660 (Ppp2r2b)
   04152 AMPK signaling pathway
    60660 (Ppp2r2b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    60660 (Ppp2r2b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    60660 (Ppp2r2b)
  09156 Nervous system
   04728 Dopaminergic synapse
    60660 (Ppp2r2b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    60660 (Ppp2r2b)
   05165 Human papillomavirus infection
    60660 (Ppp2r2b)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    60660 (Ppp2r2b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    60660 (Ppp2r2b)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    60660 (Ppp2r2b)
   03036 Chromosome and associated proteins [BR:rno03036]
    60660 (Ppp2r2b)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     60660 (Ppp2r2b)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     60660 (Ppp2r2b)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     60660 (Ppp2r2b)
SSDB
Other DBs
NCBI-GeneID: 60660
NCBI-ProteinID: NP_071545
RGD: 631441
Ensembl: ENSRNOG00000018851
UniProt: P36877
Position
18
AA seq 446 aa
MKCFSRYLPYIFRPPNTILSSSCHTEADIISTVEFNHTGELLATGDKGGRVVIFQREQES
KNQVHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKL
WKVSERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMVEATPRRVFANAHTYHIN
SISVNSDYETYMSADDLRINLWNFEITNQSFNIVDIKPANMEELTEVITAAEFHPHHCNT
FVYSSSKGTIRLCDMRASALCDRHTKFFEEPEDPSNRSFFSEIISSISDVKFSHSGRYIM
TRDYLTAKVWDLNMENRPVETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGS
YNNFFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILH
TAWHPSENIIAVAATNNLYIFQDKVN
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgaaatgcttctctcgttacctgccttatatcttcagacctccaaataccatcctctct
tccagctgccacactgaagctgacattatctctacggtagaattcaaccacactggagag
ttactagcgacgggggacaaggggggtagggttgtaatatttcagcgagaacaggagagt
aaaaatcaggttcatcgtaggggtgaatacaatgtttacagcacattccagagccatgaa
cccgagttcgattacctgaaaagtttagaaatagaagaaaaaatcaataaaataagatgg
ctccctcaacaaaatgcagcttactttcttctgtctaccaacgataaaactgtgaagcta
tggaaagttagtgagcgtgataagaggccagaaggctacaacctgaaagatgaggagggc
cggctccgggatcctgccaccatcacaaccctgcgggtgcctgtcctgagacccatggac
ttgatggtggaggccaccccacgaagagtgtttgccaatgcgcacacataccacatcaac
tccatatctgtcaacagcgactatgagacctacatgtctgctgatgacctgaggattaac
ctgtggaactttgagataaccaatcagagttttaatatcgtggacatcaagccagccaac
atggaggagctcacagaagtgatcacagcagccgagttccacccccaccactgcaacacc
tttgtatacagcagcagcaaggggacaatccggctgtgtgacatgcgggcatctgcgctg
tgtgacaggcacaccaagttttttgaagagccagaagatccaagcaatagatcgtttttc
tctgaaattatctcttcaatttcggatgtgaagttcagccacagtgggaggtatatcatg
accagagactatctgaccgcgaaagtctgggatctcaacatggaaaatcgccccgtagag
acataccaggttcatgactacctccgtagcaagttgtgctccctctacgaaaatgactgc
atttttgataaattcgagtgtgtgtggaatgggtcagacagcgtcatcatgacgggctcc
tacaataacttcttcaggatgttcgaccgaaacaccaagcgtgatgtgacccttgaggcc
tcaagggaaaacagcaaaccccgggctatcctcaaaccccgaaaagtgtgcgtcgggggc
aagcgaagaaaagatgagatcagtgttgacagtctggactttagcaaaaagatcttgcat
acagcttggcatccttcagaaaatattatagcagtggcggctacaaataacttatatata
ttccaggacaaggttaattag

KEGG   Rattus norvegicus (rat): 682033
Entry
682033            CDS       T01003                                 

Gene name
Ppp2r3b
Definition
(RefSeq) serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta
  KO
K11583  serine/threonine-protein phosphatase 2A regulatory subunit B''
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03015  mRNA surveillance pathway
rno04071  Sphingolipid signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04728  Dopaminergic synapse
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    682033 (Ppp2r3b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    682033 (Ppp2r3b)
   04151 PI3K-Akt signaling pathway
    682033 (Ppp2r3b)
   04152 AMPK signaling pathway
    682033 (Ppp2r3b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    682033 (Ppp2r3b)
  09156 Nervous system
   04728 Dopaminergic synapse
    682033 (Ppp2r3b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    682033 (Ppp2r3b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    682033 (Ppp2r3b)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    682033 (Ppp2r3b)
   03036 Chromosome and associated proteins [BR:rno03036]
    682033 (Ppp2r3b)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     682033 (Ppp2r3b)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     682033 (Ppp2r3b)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     682033 (Ppp2r3b)
SSDB
Motif
Pfam: EF-hand_13 EF-hand_7 EF-hand_5 EF-hand_1 EF-hand_6 EF-hand_8
Other DBs
NCBI-GeneID: 682033
NCBI-ProteinID: NP_001132964
RGD: 1588134
Ensembl: ENSRNOG00000049270
UniProt: B1WBU2
Position
14
AA seq 552 aa
MAPRKPPPSPLRPCLQMKVDELFLRWLSDPGTQRALRAGLRRIQGPAVILDHTVTPNPAT
ALDSATKAIAAPAKIAPPDPAVTPNPAAIASSTAITKFSASRKRNRHRAVPPRGEEPGPK
APLPGRGIPAFYFPRGRPGQGPDVDDVIADVERAFARLPSGRAGLQDMGVVAKACCCPLY
WKAPLFLAAGGGAQGGFVSARDIIGLWKPILLTCHDEAARFERLLGGPGDGGLSPEDLAP
LVQDVADSHPGLSFLREAEPLRRDYVTTVTQRVFYAVNRSWSGRISCQEIRRSCFLQAVS
QLEAEPNPGRATPSFFSYPHFCVIVSKFQALDADGDGLIDRHDLRRHADGAISSRMIDRI
FSGAVTRARPSPEGGKMGLADFVWFLLSEEDKTTPTSTEYWFRCMDLDGDGVLSAPELSF
FYEEQAQNLAARGAEPPPFADLTRQALDLVQPRCPGQITLGDLKRCGLAGEFFDAFFNAD
KFLEHERREPAGPVRAPDADPTLSDWDRFAAAEYDFLLAEEAQDDDAWEEGSESPPSSPD
PYDFADDTLDPL
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggcgccccggaagccgccgccgtcgccgctccggccttgcctgcagatgaaggttgac
gagctcttcctgcgctggctcagcgatcccggcacacaacgcgcactgcgagcaggactg
cggcgcatccaaggacctgcggtgatcctcgaccacacagtgacccccaaccccgccacg
gccctcgattccgccaccaaagccattgctgctccagccaaaattgctccgcccgacccc
gcggtgacccccaaccccgccgccattgcctcttccaccgccattactaaattttccgcc
tcacgaaaaaggaacaggcacagagcggtccctcccagaggagaggagcctgggccgaag
gccccactcccaggccgaggaattcccgccttctacttcccgcgcgggcgcccgggacag
ggacccgatgtggacgacgtaatcgcggatgtggagcgcgcattcgccaggctgccgagc
gggagggcggggctgcaggatatgggcgttgttgccaaggcctgctgctgcccactctac
tggaaggccccactgttccttgctgcaggaggtggagcacagggcggctttgtgagcgca
cgtgacatcataggcctgtggaagccgatcctgctgacctgccatgacgaagcagcccgc
ttcgaacgcctccttggtggaccaggggacggtggcctcagcccagaggaccttgcaccc
ctcgtgcaggatgttgcggactcacatcctggcctgagcttcctgcgggaggcagagccg
ctccgccgggattatgtcaccacggtgacacagcgtgtgttctacgctgtgaaccggtct
tggtctgggcggatctcttgccaggagattagacgaagctgcttcctgcaggccgtgtcc
cagctggaggcggaacccaaccccggccgtgccacaccatcattcttctcctatccccac
ttttgcgtcattgtcagcaaatttcaggccctggatgctgatggcgacggcctgattgat
aggcacgacctccggcggcatgcggatggcgccatctcctctaggatgatcgacaggatc
ttctcaggcgcagtgacccgagcacggccatcccccgagggtgggaagatggggctcgcg
gacttcgtgtggttcctgctgtcggaggaggacaagaccacgcccaccagcactgagtac
tggttccgctgcatggacctggatggggacggcgtcctttccgccccagagctcagcttc
ttctacgaggaacaggcgcagaacctggcagcccggggggcggagcctccgcccttcgct
gacctcacccggcaggcccttgacttggtgcagccacgctgccctggccagatcacgctg
ggcgacctgaagcgctgcggcctggcgggcgagttctttgatgcctttttcaatgctgac
aaattcctggagcacgaacggcgggagccagcggggcctgtgagggccccggatgccgac
cccaccctctccgactgggataggttcgctgcagcggagtacgacttcctgcttgctgag
gaggcacaggatgatgacgcgtgggaggaggggtctgagtccccgcccagctccccggat
ccctacgacttcgcagatgacaccctagatccgctgtga

KEGG   Rattus norvegicus (rat): 691318
Entry
691318            CDS       T01003                                 

Gene name
Ppp2r5c
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03015  mRNA surveillance pathway
rno04071  Sphingolipid signaling pathway
rno04114  Oocyte meiosis
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04728  Dopaminergic synapse
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    691318 (Ppp2r5c)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    691318 (Ppp2r5c)
   04151 PI3K-Akt signaling pathway
    691318 (Ppp2r5c)
   04152 AMPK signaling pathway
    691318 (Ppp2r5c)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    691318 (Ppp2r5c)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    691318 (Ppp2r5c)
  09156 Nervous system
   04728 Dopaminergic synapse
    691318 (Ppp2r5c)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    691318 (Ppp2r5c)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    691318 (Ppp2r5c)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    691318 (Ppp2r5c)
   03036 Chromosome and associated proteins [BR:rno03036]
    691318 (Ppp2r5c)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     691318 (Ppp2r5c)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     691318 (Ppp2r5c)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     691318 (Ppp2r5c)
SSDB
Motif
Pfam: B56 MvaI_BcnI
Other DBs
NCBI-GeneID: 691318
NCBI-ProteinID: NP_001178041
RGD: 1585097
Ensembl: ENSRNOG00000004973
UniProt: D4A1A5
Position
6
AA seq 524 aa
MLTCNKAGSGMVVDAASSNGPFQPVALLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPL
SDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEAVHMFAVNMFRTLPPSSNPTGAEFDP
EEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERD
FLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLK
EEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVMALLKYWPKTHSPK
EVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLIS
DNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEK
LKMKEREEAWVKIENLAKANPQYAVYSQASAMSIPVAMETDGPQFEDVQMLKKTVSDETR
QAQKDLKKDRPLVRRKSELPQDPHTEKALEAHCRASELLSQDGR
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgttgacatgtaataaagcgggcagcgggatggtggtggatgcggccagctccaacggg
cctttccagcccgtggcccttctccacattcgagatgttcctcctgcagatcaagagaag
ctttttatccagaagctacgtcagtgttgtgtcctctttgactttgtttctgacccactg
agtgacctgaagtggaaggaggtaaagcgagctgcactcagtgagatggtggaatatatc
acacacaaccggaacgtaatcacggagcccatttaccccgaggccgtccacatgtttgca
gttaacatgtttcgaaccttgccaccctcctccaatcctacgggagcagaattcgaccca
gaagaagatgaaccaacgttagaagccgcctggcctcatctgcagcttgtttatgaattt
ttcttaagatttttagagtctccagatttccagcccaatatagcaaagaaatatattgat
cagaagtttgtattgcagcttctagagctctttgacagcgaggatcctcgggagagagat
tttctaaaaactaccctgcacagaatctatgggaagttcttaggcctgcgcgcttacatc
aggaaacagatcaataatatattttataggtttatctatgagacagagcatcacaatggc
atagcagagttactggagatcctgggaagtataattaatggatttgccttaccactaaag
gaagagcacaagattttcctgttaaaggtgttgctgcccttgcacaaagtgaaatccctg
agtgtctaccatccccagctggcgtactgtgtcgtgcagtttttagagaaggacagcacc
ctcactgaaccagtggtaatggcacttctcaaatactggccaaagactcacagtccaaaa
gaagtaatgttcttaaatgaattagaagaaatcttagatgtaattgaaccatcagaattt
gtgaagatcatggagcctcttttccgacagttagccaaatgtgtttccagccctcacttc
caggtggcagagcgggcgctgtattactggaacaatgagtacatcatgagtttaatcagt
gacaatgcagcgaagattctgcccatcatgtttccatccttataccgcaactcaaagacc
cactggaacaagaccatacacggcttgatatacaacgccctgaaactcttcatggagatg
aaccaaaaactcttcgatgactgcacgcagcagttcaaagcagagaaactcaaagagaag
ctaaaaatgaaagagcgagaagaagcgtgggttaaaatagaaaatctagccaaagcgaat
ccccagtatgcagtgtatagtcaagccagcgccatgagcatcccggttgccatggagaca
gatggtcctcagtttgaagatgtgcagatgctgaaaaagacagtgagcgacgagactcgt
caggcacagaaggatctgaagaaggaccgtccccttgtgcgccgcaagtccgagctgcct
caggacccccacaccgagaaagccttggaagctcactgcagagccagtgagctgctctcc
caggacgggcgctag

DBGET integrated database retrieval system