KEGG   Rattus norvegicus (rat): 117106
Entry
117106            CDS       T01003                                 

Gene name
Scarb2
Definition
(RefSeq) lysosome membrane protein 2 precursor
  KO
K12384  lysosome membrane protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    117106 (Scarb2)
SSDB
Motif
Pfam: CD36
Other DBs
NCBI-GeneID: 117106
NCBI-ProteinID: NP_446453
RGD: 621882
Ensembl: ENSRNOG00000002225
UniProt: P27615
Position
14
AA seq 478 aa
MARCCFYTAGTLSLLLLVTSVTLLVARVFQKAVDQTIEKNMVLQNGTKVFDSWEKPPLPV
YIQFYFFNVTNPEEILQGEIPLLEEVGPYTYRELRNKANVQFGENGTTISAVTNKAYIFE
RNQSVGDPTVDLIRTINIPLLTVVEMAQQPFLREIIEAMLKAYQQTLFVTHTVHELLWGY
KDEVLSLVHIFRPDVSPNFGLFYERNGTNDGEYVFLTGEDNYLNFTKIVEWNGKTSLDWW
TTDTCNMINGTDGDSFHPLISKDETLYIFPSDFCRSVYITFSSFENVEGLPAFRYKVPAE
ILANSSENAGFCIPEGNCMDAGVLNVSICKNGAPIIMSFPHFYQADEKFVSAIKGMRPNK
EEHESFVDINPLTGIILRGAKRFQINTYVKKLDDFVETGNIRTMVFPVMYLNESVLIDKE
TASQLKSVINTTLIVTNIPYIIMALGVFFGLIFTWLACRGQGSTDEGTADERAPLIRT
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggcccgatgctgcttctacacggcggggacactgtctctgctgctgctggtgaccagt
gtcacgctgctagtggctcgagtctttcagaaggcagtggaccagacgatcgagaagaat
atggtattacaaaatggtaccaaggtctttgattcctgggagaagccccctctacctgtg
tacatccagttttatttcttcaatgtcaccaatccagaggagatcctccaaggagaaatc
cccctgctagaagaagtggggccgtacacctacagggagctcaggaacaaggcaaacgtt
cagtttggagaaaatggaacaaccatatctgccgtcaccaataaggcatatatttttgaa
cgaaaccagtctgttggagaccctaccgttgacttgattagaacaataaatattcctctg
ttgactgttgtggaaatggcccagcagcccttcctcagggagatcatcgaggccatgctg
aaagcttatcagcagacgctgtttgtcactcacactgtacatgaactgctctggggctac
aaagatgaggtcttgtcgctcgtccatattttcagacctgacgtctcccctaactttggc
ctgttctatgagagaaatggaactaatgatggggagtatgtttttctgactggagaggac
aattacctgaactttacaaaaattgtggagtggaatggaaaaacgtcgctggactggtgg
acgacggacacgtgcaatatgatcaacgggacagacggagattcttttcacccattaata
agcaaggatgagaccctgtacatcttcccatctgacttctgcaggtccgtctatataact
ttcagtagctttgagaacgtagaaggactgcctgcttttcggtataaggtgcctgcagaa
atactagccaattcctccgaaaacgctggcttctgtatacccgagggaaactgcatggac
gcgggagtgctgaacgtcagcatttgcaagaatggtgcgcccattatcatgtctttccca
cacttttaccaagccgacgagaagttcgtttcggccataaaaggcatgcgtccaaacaag
gaagaacatgagtcatttgtggacattaatcctttgacaggaattattttaagaggggcc
aagagattccaaatcaacacgtacgttaagaagctggatgactttgtggaaacgggaaac
attaggactatggttttcccagtgatgtatctcaatgagagtgttctcattgacaaagag
actgcaagtcaactgaagtctgtgattaacacaactttgattgtcaccaacataccctac
atcatcatggcactgggcgtgttctttggcttgattttcacgtggctggcgtgtcgagga
caggggtctacggatgagggaactgcagatgaaagggcacccctcatacggacctaa

KEGG   Rattus norvegicus (rat): 29186
Entry
29186             CDS       T01003                                 

Gene name
Cd63
Definition
(RefSeq) CD63 antigen
  KO
K06497  CD63 antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    29186 (Cd63)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    29186 (Cd63)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    29186 (Cd63)
   04090 CD molecules [BR:rno04090]
    29186 (Cd63)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   29186 (Cd63)
CD molecules [BR:rno04090]
 Proteins
  29186 (Cd63)
SSDB
Motif
Pfam: Tetraspanin DUF6057 DUF2070 DUF4834
Other DBs
NCBI-GeneID: 29186
NCBI-ProteinID: NP_058821
RGD: 62080
Ensembl: ENSRNOG00000007650
UniProt: P28648
Position
7
AA seq 238 aa
MAVEGGMKCVKFLLYVLLLAFCACAVGLIAIGVAVQVVLKQAITHETTAGSLLPVVIIAV
GAFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQVKSEFSKSFQ
KQMQNYLTDNKTATILDKLQKENKCCGASNYTDWERIPGMAKDRVPDSCCINITVGCGND
FKESTIHTQGCVETIAAWLRKNVLLVAGAALGIAFVEVLGIIFSCCLVKSIRSGYEVM
NT seq 717 nt   +upstreamnt  +downstreamnt
atggcggtggaaggaggaatgaagtgtgtcaagtttttgctctacgttctcctactggcc
ttttgcgcctgcgcagtgggattgattgccattggcgtagcagttcaggttgtcttgaag
caggccattacccacgagactactgctggctcgctgttgcctgtggtcatcattgcagtg
ggtgccttcctcttcctggtggcctttgtgggctgctgtggggcctgcaaagagaactac
tgtctcatgattacatttgccatcttcctgtctcttatcatgctcgtggaggtggcggtg
gccattgctggctatgtgtttagagaccaggtgaagtcagagtttagtaagagcttccag
aagcagatgcagaattaccttacagacaacaaaacggccaccattttggacaaattgcag
aaggaaaataaatgctgtggagcctctaactacacagactgggagcgcatccccggtatg
gccaaggacagggtccccgattcttgctgcatcaacatcactgtgggctgtggaaacgat
ttcaaggaatccaccatccatacccagggctgcgtggaaactatagcggcatggctgagg
aagaacgtactgctggtggctggagcagccctgggcattgcttttgtggaggtcctgggc
attatcttctcctgctgtctggtgaagagtatccggagtggctacgaagtaatgtag

DBGET integrated database retrieval system