KEGG   Rattus norvegicus (rat): 117108Help
Entry
117108            CDS       T01003                                 

Gene name
B3gat1, Hnk-1
Definition
(RefSeq) beta-1,3-glucuronyltransferase 1
  KO
K00735  galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 [EC:2.4.1.135]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00515  Mannose type O-glycan biosynthesis
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    117108 (B3gat1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    117108 (B3gat1)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.135  galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase
     117108 (B3gat1)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  O-Glycan
   117108 (B3gat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_43
Motif
Other DBs
NCBI-GeneID: 117108
NCBI-ProteinID: NP_446455
RGD: 70880
Ensembl: ENSRNOG00000007142
UniProt: O35789
Position
8q13
AA seq 347 aa AA seqDB search
MGNEELWAQPALEMPKRRDILAIVLIVLPWTLLITVWHQSSLAPLLAVHKDEGSDPRHEA
PPGADPREYCMSDRDIVEVVRTEYVYTRPPPWSDTLPTIHVVTPTYSRPVQKAELTRMAN
TLLHVPNLHWLVVEDAPRRTPLTARLLRDTGLNYTHLHVETPRNYKLRGDARDPRIPRGT
MQRNLALRWLRETFPRNSTQPGVVYFADDDNTYSLELFEEMRSTRRVSVWPVAFVGGLRY
EAPRVNGAGKVVGWKTVFDPHRPFAIDMAGFAVNLRLILQRSQAYFKLRGVKGGYQESSL
LRELVTLNDLEPKAANCTKILVWHTRTEKPVLVNEGKKGFTDPSVEI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgggtaatgaggagctgtgggcgcagccagccttggagatgccgaagagaagggacatc
ctcgcgattgtcctcattgtgcttccctggacactgctcatcaccgtctggcaccagagc
agcctcgcacctctgcttgctgtgcacaaggatgagggaagtgacccccgccatgaggca
ccacccggtgcggaccctagggagtactgcatgtccgaccgtgacatcgtggaggtggtg
cgcacagagtacgtgtacacgaggccgccaccgtggtccgacacgctgcccaccatccat
gtggtgacgcccacctacagtagaccggtgcagaaggcagagctgacgcgaatggccaac
acgctattgcatgtgcccaaccttcactggctggtggtggaggatgctccacgtaggacg
cccctcacagcgcgcctgctgcgcgacactggcctcaactatacacacctgcacgtagag
acaccacgcaactacaagctgcgaggtgacgcccgagaccctcgcatcccacgtggcacc
atgcagcgcaatctggccctgcgctggttgcgggagaccttcccacggaactccactcag
ccgggtgtagtgtacttcgcagatgacgacaacacgtacagtctggagctctttgaagag
atgcgcagcacaagaagggtgtccgtgtggcctgtggcctttgttggcggccttcggtat
gaggccccccgggtgaatggggcagggaaagtggttggctggaagacagtcttcgacccc
caccggccatttgcaatagacatggctggatttgctgtcaacctccggctcatcttgcaa
cgaagccaggcctactttaagctacgtggggtaaaaggaggctaccaggaaagcagtctc
cttcgagaacttgtcaccctcaatgatctagagcccaaggcagcaaactgtaccaagatc
ctggtctggcatacgcgaacagagaagccagtgctggtgaatgaggggaagaagggcttc
actgacccctcggtggagatctga

DBGET integrated database retrieval system