KEGG   Rattus norvegicus (rat): 117180
Entry
117180            CDS       T01003                                 

Gene name
Csde1, Unr
Definition
(RefSeq) cold shock domain containing E1, RNA binding
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: CSD SUZ-C S1-like CusF_Ec DrrA_P4M
Other DBs
NCBI-GeneID: 117180
NCBI-ProteinID: NP_446458
RGD: 619726
Ensembl: ENSRNOG00000061058
UniProt: P18395
Position
2q34
AA seq 798 aa
MSFDPNLLHNNGHNGYPNGTSAALRETGVIEKLLTSYGFIQCSERQARLFFHCSQYNGNL
QDLKVGDDVEFEVSSDRRTGKPIAIKLVKIKPEIHPEERMNGQVVCAVPHNLESKSPAAP
GQSPTGSVCYERNGEVFYLTYTSEDVEGNVQLETGDKINFVIDNNKHTGAVSARNIMLLK
KKQARYQGVVCAMKEAFGFIERGDVVKEIFFHYSEFKGDLETLQPGDDVEFTIKDRNGKE
VATDVRLLPQGTVIFEDISIEHFEGTVTKVIPKVPSKNQNDPLPGRIKVDFVIPKELPFG
DKDTKSKVTLLEGDHVRFNISTDRRDKLERATNIEVLSNTFQFTNEAREMGVIAAMRDGF
GFIKCVDRDARMFFHFSEILDGNQLHIADEVEFTVVPDMLSAQRNHAIRIKKLPKGTVSF
HSHSDHRFLGTVEKEATFSNPKTTSPNKGKDKEAEDGIIAYDDCGVKLTIAFQAKDVEGS
TSPQIGDKVEFSISDKQRPGQQIATCVRLLGRNSNSKRLLGYVATLKDNFGFIETANHDK
EIFFHYSEFSGDVDSLELGDMVEYSLSKGKGNKVSAEKVNKTHSVNGITEEANPTIYSGK
VIRPLRGVDPTQIEYQGMIEIVEEGDMKGEVYPFGIVGMANKGDCLQKGESVKFQLCVLG
QNAQTMAYNITPLRRATVECVKDQFGFINYEVGDSKKLFFHVKEVQDGIELQAGDEVEFS
VILNQRTGKCSACNVWRVCEGPKAVAAPRPDRLVNRLKNITLDDASAPRLMVLRQPRGPD
NSMGFGAERKIRQAGVID
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgagctttgatccaaaccttctccacaacaatggacacaacgggtaccccaatggtact
tctgcagcactccgtgaaactggggttattgaaaaactgctgacctcttatggatttatt
cagtgttcagaacggcaagctaggcttttcttccactgttcacagtataatggcaacctc
caggacttaaaagtaggagatgatgtggaatttgaagtatcatctgaccggaggactggg
aaacctattgctattaaattggtgaagataaaaccagaaatacatcctgaagaacgaatg
aatggacaagttgtgtgcgctgttcctcacaacttagagagtaaatctccagctgccccg
ggtcagagtccaacagggagtgtatgctacgaacgtaatggggaagtattttatctgact
tacacctctgaagatgtggaagggaacgttcagctggaaactggagacaaaattaacttt
gtaattgataacaataaacacactggtgctgtaagtgctcgtaacattatgctgttgaaa
aagaaacaagctcgctatcaaggagtagtttgtgccatgaaggaggcgtttggctttatt
gaaagaggtgatgttgtaaaagagatattctttcactatagtgaatttaaaggtgatcta
gaaaccctgcagcctggagatgacgtggaattcacaatcaaggacagaaatggtaaagaa
gttgcaacagatgtcagactattgcctcaaggaacagtcatttttgaagatatcagcatt
gaacattttgaaggaactgtaaccaaagttatcccaaaagtacccagtaaaaaccagaat
gacccattgccaggacgaatcaaagttgactttgtgattcctaaagaacttccctttgga
gacaaagacacaaaatccaaagtgaccctgctggaaggtgaccatgttaggtttaatatt
tcaacagaccgacgtgacaaattagaacgagcaaccaacatagaggttctatcaaataca
tttcagttcactaatgaagccagagagatgggtgtgattgctgccatgagagatggtttt
ggcttcatcaagtgtgtggaccgtgatgctcgtatgttcttccacttcagtgagattctc
gatgggaaccagctccacattgcagatgaagtggagtttactgtggtccctgatatgctc
tctgcccaaagaaatcatgctattaggattaaaaaacttcccaagggcacggtttcattc
cattcccattcagatcatcgttttctgggcaccgtagaaaaagaagccactttttctaat
cctaaaactacaagcccaaataaaggcaaagacaaggaggcagaagatggcattattgct
tatgatgactgtggggtgaaactgactattgcttttcaagccaaggatgtggaaggatct
acttctcctcaaataggagataaggttgaatttagtattagtgacaaacagaggcctgga
cagcagattgcaacttgtgtgagacttttaggtcgtaattctaattccaaaaggctcttg
ggttatgtggcaactctgaaagataattttggatttattgaaacagctaatcatgataag
gagatatttttccattatagtgagttctctggtgatgttgatagcctggaactgggagac
atggttgaatacagcttgtccaaaggcaaaggcaataaagtcagtgctgagaaagtaaac
aaaactcactcagtgaatggcatcactgaggaagcaaatcccaccatctactctggtaaa
gtcattcgtcctctgagaggcgttgatccaacacagattgaataccaaggaatgattgag
attgtggaggagggggatatgaaaggtgaagtgtatccttttggcatagttgggatggcc
aacaaaggggattgcctacagaaaggggagagtgttaagttccagttgtgtgtacttggc
caaaatgcacaaactatggcctacaacatcacaccccttcgtagggctactgtggagtgt
gtgaaagatcagtttggctttattaactatgaagtaggagatagcaagaagctctttttc
catgtgaaggaagttcaggatggcattgagctacaggcaggagatgaggtggaattctca
gtgatccttaatcagcgcactgggaaatgtagcgcctgtaatgtttggcgagtctgtgaa
ggccccaaagctgttgcagctcctcgacctgatcggttggttaatcgcttaaagaacatc
accctggatgatgccagtgctccacgtctaatggttcttcgtcagccaaggggaccagat
aactcaatgggatttggtgcagaaagaaagatccgtcaagctggtgtcattgactaa

DBGET integrated database retrieval system